Scan-x logo
                         v1.1 03.04.09

Phosphorylation prediction results for
Human herpesvirus 5
virPTM logo


                                                                                                                  Total     Max
Rank Score Score
37/2881) gi|9625710|ref|NP_039959.1| UL25 [Human herpesvirus 5 strain AD169] 442.534 42.634 38/2881) gi|52139211|ref|YP_081484.1| tegument protein UL25 [Human herpesvirus 5] 442.534 42.634 56/2881) gi|9625735|ref|NP_039984.1| UL50 [Human herpesvirus 5 strain AD169] 137.845 37.367 69/2881) gi|52139237|ref|YP_081509.1| nuclear egress membrane protein [Human herpesvirus 5] 134.756 35.209 70/2881) gi|9625811|ref|NP_040060.1| IE1 [Human herpesvirus 5 strain AD169] 297.166 35.207 106/2881) gi|52139244|ref|YP_081517.1| multifunctional expression regulator [Human herpesvirus 5] 225.733 32.044 107/2881) gi|9625754|ref|NP_040003.1| UL69 [Human herpesvirus 5 strain AD169] 233.275 32.044 138/2881) gi|52139335|ref|YP_081610.1| protein US26 [Human herpesvirus 5] 326.173 30.402 139/2881) gi|9625862|ref|NP_040111.1| US26 [Human herpesvirus 5 strain AD169] 326.173 30.402 140/2881) gi|52139337|ref|YP_081612.1| envelope protein US28 [Human herpesvirus 5] 127.952 30.345 161/2881) gi|9625836|ref|NP_040085.1| IRS1 [Human herpesvirus 5 strain AD169] 105.986 29.702 162/2881) gi|52139312|ref|YP_081587.1| tegument protein IRS1 [Human herpesvirus 5] 105.205 29.702 174/2881) gi|9625844|ref|NP_040093.1| US8 [Human herpesvirus 5 strain AD169] 116.852 29.408 175/2881) gi|52139318|ref|YP_081593.1| membrane glycoprotein US8 [Human herpesvirus 5] 116.852 29.408 180/2881) gi|28373220|ref|NP_783796.1| IE2 [Human herpesvirus 5 strain AD169] 450.765 29.258 181/2881) gi|52139286|ref|YP_081561.1| regulatory protein IE2 [Human herpesvirus 5] 453.585 29.258 186/2881) gi|52139301|ref|YP_081576.1| protein UL140 [Human herpesvirus 5] 181.139 29.129 204/2881) gi|9625720|ref|NP_039969.1| UL35 [Human herpesvirus 5 strain AD169] 205.307 28.669 205/2881) gi|52139221|ref|YP_081494.1| tegument protein UL35 [Human herpesvirus 5] 205.869 28.669 206/2881) gi|9625848|ref|NP_040097.1| US12 [Human herpesvirus 5 strain AD169] 52.966 28.582 207/2881) gi|52139322|ref|YP_081597.1| membrane protein US12 [Human herpesvirus 5] 52.966 28.582 263/2881) gi|9625820|ref|NP_040069.1| UL132 [Human herpesvirus 5 strain AD169] 92.634 26.954 264/2881) gi|52139292|ref|YP_081567.1| envelope glycoprotein UL132 [Human herpesvirus 5] 92.634 26.954 266/2881) gi|52139254|ref|YP_081529.1| capsid scaffold protein [Human herpesvirus 5] 209.984 26.877 267/2881) gi|52139253|ref|YP_081528.1| capsid maturation protease [Human herpesvirus 5] 348.113 26.877 268/2881) gi|9625766|ref|NP_040015.1| UL80.5 [Human herpesvirus 5 strain AD169] 194.366 26.877 269/2881) gi|9625765|ref|NP_040014.1| UL80 [Human herpesvirus 5 strain AD169] 332.495 26.877 304/2881) gi|52139218|ref|YP_081491.1| tegument protein pp150 [Human herpesvirus 5] 481.427 25.878 305/2881) gi|9625717|ref|NP_039966.1| UL32 [Human herpesvirus 5 strain AD169] 495.755 25.878 340/2881) gi|52139187|ref|YP_081460.1| membrane protein RL12 [Human herpesvirus 5] 89.242 25.088 367/2881) gi|52139246|ref|YP_081520.1| deoxyuridine triphosphatase [Human herpesvirus 5] 136.289 24.625 372/2881) gi|9625781|ref|NP_040030.1| UL95 [Human herpesvirus 5 strain AD169] 157.319 24.529 373/2881) gi|52139267|ref|YP_081542.1| protein UL95 [Human herpesvirus 5] 157.319 24.529 382/2881) gi|9625770|ref|NP_040019.1| UL84 [Human herpesvirus 5 strain AD169] 74.126 24.335 383/2881) gi|52139257|ref|YP_081532.1| protein UL84 [Human herpesvirus 5] 93.971 24.335 385/2881) gi|52139247|ref|YP_081522.1| envelope glycoprotein O [Human herpesvirus 5] 58.709 24.283 391/2881) gi|28373227|ref|NP_783803.1| US1 [Human herpesvirus 5 strain AD169] 95.155 24.142 396/2881) gi|52139256|ref|YP_081531.1| tegument protein pp65 [Human herpesvirus 5] 170.939 24.042 397/2881) gi|9625769|ref|NP_040018.1| UL83 [Human herpesvirus 5 strain AD169] 170.939 24.042 411/2881) gi|52139271|ref|YP_081546.1| myristylated tegument protein [Human herpesvirus 5] 206.450 23.646 412/2881) gi|9625785|ref|NP_040034.1| UL99 [Human herpesvirus 5 strain AD169] 206.450 23.646 416/2881) gi|9625739|ref|NP_039988.1| UL54 [Human herpesvirus 5 strain AD169] 141.945 23.579 417/2881) gi|52139240|ref|YP_081513.1| DNA polymerase catalytic subunit [Human herpesvirus 5] 129.740 23.579 443/2881) gi|52139338|ref|YP_081613.1| protein US29 [Human herpesvirus 5] 45.055 23.146 444/2881) gi|9625865|ref|NP_040114.1| US29 [Human herpesvirus 5 strain AD169] 45.055 23.146 449/2881) gi|52139287|ref|YP_081562.1| regulatory protein IE1 [Human herpesvirus 5] 276.773 23.004 499/2881) gi|52139262|ref|YP_081537.1| DNA packaging terminase subunit 1 [Human herpesvirus 5] 60.696 22.422 500/2881) gi|9625775|ref|NP_040024.1| UL89 [Human herpesvirus 5 strain AD169] 60.696 22.422 520/2881) gi|28373231|ref|NP_783808.1| US28 [Human herpesvirus 5 strain AD169] 153.544 22.091 541/2881) gi|52139206|ref|YP_081479.1| membrane protein UL20 [Human herpesvirus 5] 27.457 21.818 542/2881) gi|9625705|ref|NP_039954.1| UL20 [Human herpesvirus 5 strain AD169] 27.457 21.818 554/2881) gi|52139210|ref|YP_081483.1| tegument protein UL24 [Human herpesvirus 5] 41.749 21.643 555/2881) gi|28373246|ref|NP_783778.1| UL24 [Human herpesvirus 5 strain AD169] 41.749 21.643 558/2881) gi|52139305|ref|YP_081580.1| protein UL135 [Human herpesvirus 5] 191.186 21.565 567/2881) gi|52139278|ref|YP_081553.1| protein UL112 [Human herpesvirus 5] 238.186 21.400 568/2881) gi|9625801|ref|NP_040050.1| UL112 [Human herpesvirus 5 strain AD169] 238.186 21.400 591/2881) gi|9625757|ref|NP_040006.1| UL72 [Human herpesvirus 5 strain AD169] 151.902 21.236 620/2881) gi|52139265|ref|YP_081540.1| DNA packaging tegument protein UL17 [Human herpesvirus 5] 167.168 20.938 661/2881) gi|52139230|ref|YP_081503.1| ribonucleotide reductase subunit 1 [Human herpesvirus 5] 101.533 20.517 662/2881) gi|9625730|ref|NP_039979.1| UL45 [Human herpesvirus 5 strain AD169] 101.533 20.517 664/2881) gi|52139249|ref|YP_081524.1| nuclear protein UL24 [Human herpesvirus 5] 51.524 20.500 684/2881) gi|52139300|ref|YP_081575.1| membrane glycoprotein UL141 [Human herpesvirus 5] 40.668 20.355 688/2881) gi|52139182|ref|YP_081455.1| protein RL1 [Human herpesvirus 5] 43.976 20.297 694/2881) gi|52139333|ref|YP_081608.1| protein US23 [Human herpesvirus 5] 106.294 20.224 695/2881) gi|9625859|ref|NP_040108.1| US23 [Human herpesvirus 5 strain AD169] 97.579 20.224 701/2881) gi|9625779|ref|NP_040028.1| UL93 [Human herpesvirus 5 strain AD169] 140.030 20.163 708/2881) gi|52139269|ref|YP_081544.1| tegument serine/threonine protein kinase [Human herpesvirus 5] 85.645 20.122 736/2881) gi|52139303|ref|YP_081578.1| protein UL138 [Human herpesvirus 5] 49.905 19.800 747/2881) gi|52139311|ref|YP_081586.1| protein UL150 [Human herpesvirus 5] 95.473 19.717 752/2881) gi|52139197|ref|YP_081470.1| protein UL10 [Human herpesvirus 5] 25.325 19.636 755/2881) gi|9625723|ref|NP_039972.1| UL38 [Human herpesvirus 5 strain AD169] 52.515 19.599 762/2881) gi|52139205|ref|YP_081478.1| protein UL19 [Human herpesvirus 5] 42.810 19.561 763/2881) gi|9625704|ref|NP_039953.1| UL19 [Human herpesvirus 5 strain AD169] 42.810 19.561 767/2881) gi|9625791|ref|NP_040039.1| UL104 [Human herpesvirus 5 strain AD169] 101.403 19.516 768/2881) gi|52139275|ref|YP_081550.1| capsid portal protein [Human herpesvirus 5] 101.403 19.516 818/2881) gi|9625773|ref|NP_040022.1| UL87 [Human herpesvirus 5 strain AD169] 145.438 19.133 819/2881) gi|52139260|ref|YP_081535.1| protein UL87 [Human herpesvirus 5] 140.697 19.133 831/2881) gi|52139241|ref|YP_081514.1| envelope glycoprotein B [Human herpesvirus 5] 112.809 19.013 850/2881) gi|52139228|ref|YP_081501.1| tegument protein UL43 [Human herpesvirus 5] 134.797 18.833 851/2881) gi|28373239|ref|NP_783785.1| UL43 [Human herpesvirus 5 strain AD169] 134.797 18.833 854/2881) gi|52139245|ref|YP_081518.1| helicase-primase primase subunit [Human herpesvirus 5] 93.845 18.829 855/2881) gi|28373251|ref|NP_783788.1| UL70 [Human herpesvirus 5 strain AD169] 93.845 18.829 865/2881) gi|52139238|ref|YP_081512.1| nuclear egress lamina protein [Human herpesvirus 5] 45.412 18.758 866/2881) gi|9625738|ref|NP_039987.1| UL53 [Human herpesvirus 5 strain AD169] 45.412 18.758 871/2881) gi|9625681|ref|NP_039930.1| RL10 [Human herpesvirus 5 strain AD169] 43.366 18.708 872/2881) gi|9625825|ref|NP_040074.1| RL10 [Human herpesvirus 5 strain AD169] 43.366 18.708 875/2881) gi|52139313|ref|YP_081588.1| protein US1 [Human herpesvirus 5] 89.704 18.691 883/2881) gi|9625873|ref|NP_040122.1| TRS1 [Human herpesvirus 5 strain AD169] 52.732 18.491 892/2881) gi|9625741|ref|NP_039990.1| UL56 [Human herpesvirus 5 strain AD169] 63.928 18.433 893/2881) gi|52139242|ref|YP_081515.1| DNA packaging terminase subunit 2 [Human herpesvirus 5] 63.928 18.433 895/2881) gi|52139332|ref|YP_081607.1| tegument protein US22 [Human herpesvirus 5] 87.523 18.429 896/2881) gi|28373241|ref|NP_783806.1| US22 [Human herpesvirus 5 strain AD169] 87.523 18.429 900/2881) gi|9625762|ref|NP_040011.1| UL77 [Human herpesvirus 5 strain AD169] 58.907 18.380 904/2881) gi|9625783|ref|NP_040032.1| UL97 [Human herpesvirus 5 strain AD169] 84.284 18.363 907/2881) gi|28373240|ref|NP_783791.1| UL102 [Human herpesvirus 5 strain AD169] 63.850 18.329 908/2881) gi|52139273|ref|YP_081548.1| helicase-primase subunit [Human herpesvirus 5] 63.850 18.329 917/2881) gi|52139266|ref|YP_081541.1| tegument protein UL16 [Human herpesvirus 5] 44.041 18.264 918/2881) gi|9625780|ref|NP_040029.1| UL94 [Human herpesvirus 5 strain AD169] 42.505 18.264 978/2881) gi|28373217|ref|NP_783772.1| UL10 [Human herpesvirus 5 strain AD169] 41.361 17.865 1000/2881) gi|52139344|ref|YP_081619.1| tegument protein TRS1 [Human herpesvirus 5] 51.627 17.710 1010/2881) gi|28373225|ref|NP_783782.1| UL34 [Human herpesvirus 5 strain AD169] 17.661 17.661 1014/2881) gi|9625737|ref|NP_039986.1| UL52 [Human herpesvirus 5 strain AD169] 50.725 17.647 1015/2881) gi|52139239|ref|YP_081511.1| DNA packaging protein UL32 [Human herpesvirus 5] 50.725 17.647 1019/2881) gi|52139224|ref|YP_081497.1| protein UL38 [Human herpesvirus 5] 53.262 17.630 1039/2881) gi|52139208|ref|YP_081481.1| glycoprotein UL22A [Human herpesvirus 5] 55.103 17.538 1040/2881) gi|28373245|ref|NP_783776.1| UL22A [Human herpesvirus 5 strain AD169] 63.889 17.538 1059/2881) gi|52139316|ref|YP_081591.1| membrane glycoprotein US6 [Human herpesvirus 5] 33.687 17.379 1060/2881) gi|9625842|ref|NP_040091.1| US6 [Human herpesvirus 5 strain AD169] 33.687 17.379 1069/2881) gi|9625733|ref|NP_039982.1| UL48 [Human herpesvirus 5 strain AD169] 156.190 17.280 1070/2881) gi|52139234|ref|YP_081506.1| large tegument protein [Human herpesvirus 5] 153.583 17.280 1072/2881) gi|9625868|ref|NP_040117.1| US32 [Human herpesvirus 5 strain AD169] 138.343 17.265 1073/2881) gi|52139341|ref|YP_081616.1| protein US32 [Human herpesvirus 5] 138.343 17.265 1075/2881) gi|9625721|ref|NP_039970.1| UL36 [Human herpesvirus 5 strain AD169] 36.477 17.259 1076/2881) gi|52139255|ref|YP_081530.1| tegument protein pp71 [Human herpesvirus 5] 119.182 17.255 1077/2881) gi|9625768|ref|NP_040017.1| UL82 [Human herpesvirus 5 strain AD169] 119.182 17.255 1089/2881) gi|52139261|ref|YP_081536.1| tegument protein UL88 [Human herpesvirus 5] 45.643 17.182 1090/2881) gi|9625774|ref|NP_040023.1| UL88 [Human herpesvirus 5 strain AD169] 45.643 17.182 1093/2881) gi|52139302|ref|YP_081577.1| membrane glycoprotein UL139 [Human herpesvirus 5] 29.253 17.133 1094/2881) gi|9625740|ref|NP_039989.1| UL55 [Human herpesvirus 5 strain AD169] 109.164 17.132 1125/2881) gi|52139232|ref|YP_081505.1| tegument protein UL37 [Human herpesvirus 5] 79.633 16.962 1126/2881) gi|28373226|ref|NP_783786.1| UL47 [Human herpesvirus 5 strain AD169] 79.633 16.962 1127/2881) gi|52139198|ref|YP_081471.1| membrane glycoprotein UL11 [Human herpesvirus 5] 20.839 16.936 1166/2881) gi|34422126|ref|NP_899642.1| RL11 [Human herpesvirus 5 strain AD169] 16.650 16.650 1167/2881) gi|34422121|ref|NP_899637.1| RL11 [Human herpesvirus 5 strain AD169] 16.650 16.650 1168/2881) gi|52139186|ref|YP_081459.1| membrane glycoprotein RL11 [Human herpesvirus 5] 29.151 16.650 1172/2881) gi|52139259|ref|YP_081534.1| major capsid protein [Human herpesvirus 5] 45.344 16.626 1173/2881) gi|9625772|ref|NP_040021.1| UL86 [Human herpesvirus 5 strain AD169] 45.344 16.626 1184/2881) gi|52139258|ref|YP_081533.1| capsid triplex subunit 2 [Human herpesvirus 5] 31.400 16.548 1185/2881) gi|9625771|ref|NP_040020.1| UL85 [Human herpesvirus 5 strain AD169] 31.400 16.548 1325/2881) gi|9625714|ref|NP_039963.1| UL29 [Human herpesvirus 5 strain AD169] 43.742 15.752 1342/2881) gi|52139215|ref|YP_081488.1| protein UL29 [Human herpesvirus 5] 27.990 15.601 1372/2881) gi|52139243|ref|YP_081516.1| single-stranded DNA-binding protein [Human herpesvirus 5] 42.217 15.474 1373/2881) gi|9625742|ref|NP_039991.1| UL57 [Human herpesvirus 5 strain AD169] 42.217 15.474 1378/2881) gi|52139220|ref|YP_081493.1| protein UL34 [Human herpesvirus 5] 29.365 15.440 1398/2881) gi|52139222|ref|YP_081495.1| tegument protein vICA [Human herpesvirus 5] 40.606 15.348 1400/2881) gi|9625863|ref|NP_040112.1| US27 [Human herpesvirus 5 strain AD169] 40.802 15.342 1401/2881) gi|52139336|ref|YP_081611.1| envelope glycoprotein US27 [Human herpesvirus 5] 40.363 15.342 1426/2881) gi|52139229|ref|YP_081502.1| DNA polymerase processivity subunit [Human herpesvirus 5] 60.281 15.198 1427/2881) gi|9625729|ref|NP_039978.1| UL44 [Human herpesvirus 5 strain AD169] 60.281 15.198 1439/2881) gi|52139319|ref|YP_081594.1| membrane glycoprotein US9 [Human herpesvirus 5] 73.466 15.127 1440/2881) gi|9625845|ref|NP_040094.1| US9 [Human herpesvirus 5 strain AD169] 73.466 15.127 1445/2881) gi|28373218|ref|NP_783794.1| UL116 [Human herpesvirus 5 strain AD169] 64.838 15.086 1451/2881) gi|9625722|ref|NP_039971.1| UL37 [Human herpesvirus 5 strain AD169] 34.275 15.078 1463/2881) gi|9625784|ref|NP_040033.1| UL98 [Human herpesvirus 5 strain AD169] 74.660 15.036 1473/2881) gi|9625690|ref|NP_039939.1| UL5 [Human herpesvirus 5 strain AD169] 19.450 14.960 1474/2881) gi|52139192|ref|YP_081465.1| protein UL5 [Human herpesvirus 5] 19.450 14.960 1476/2881) gi|28373252|ref|NP_783789.1| UL71 [Human herpesvirus 5 strain AD169] 48.523 14.941 1477/2881) gi|52139345|ref|YP_081519.1| tegument protein UL51 [Human herpesvirus 5] 43.385 14.941 1479/2881) gi|52139306|ref|YP_081581.1| protein UL133 [Human herpesvirus 5] 31.276 14.938 1480/2881) gi|52139194|ref|YP_081467.1| membrane protein UL7 [Human herpesvirus 5] 14.937 14.937 1495/2881) gi|28373228|ref|NP_783804.1| US15 [Human herpesvirus 5 strain AD169] 14.869 14.869 1496/2881) gi|52139325|ref|YP_081600.1| membrane protein US15 [Human herpesvirus 5] 14.869 14.869 1507/2881) gi|52139294|ref|YP_081569.1| membrane protein UL147A [Human herpesvirus 5] 14.786 14.786 1508/2881) gi|52139270|ref|YP_081545.1| deoxyribonuclease [Human herpesvirus 5] 58.821 14.784 1513/2881) gi|34422125|ref|NP_899641.1| RL12 [Human herpesvirus 5 strain AD169] 24.261 14.751 1514/2881) gi|34422122|ref|NP_899638.1| RL12 [Human herpesvirus 5 strain AD169] 24.261 14.751 1551/2881) gi|52139185|ref|YP_081458.1| envelope glycoprotein RL10 [Human herpesvirus 5] 24.658 14.604 1556/2881) gi|52139188|ref|YP_081461.1| membrane protein RL13 [Human herpesvirus 5] 14.569 14.569 1569/2881) gi|52139281|ref|YP_081556.1| protein UL116 [Human herpesvirus 5] 49.752 14.503 1627/2881) gi|9625802|ref|NP_040051.1| UL114 [Human herpesvirus 5 strain AD169] 26.157 14.218 1628/2881) gi|52139279|ref|YP_081554.1| uracil-DNA glycosylase [Human herpesvirus 5] 26.157 14.218 1648/2881) gi|28373223|ref|NP_783777.1| UL23 [Human herpesvirus 5 strain AD169] 22.385 14.131 1649/2881) gi|52139209|ref|YP_081482.1| tegument protein UL23 [Human herpesvirus 5] 22.385 14.131 1670/2881) gi|52139297|ref|YP_081572.1| protein UL145 [Human herpesvirus 5] 25.785 14.023 1678/2881) gi|52139193|ref|YP_081466.1| protein UL6 [Human herpesvirus 5] 22.510 13.988 1679/2881) gi|9625691|ref|NP_039940.1| UL6 [Human herpesvirus 5 strain AD169] 22.510 13.988 1681/2881) gi|9625778|ref|NP_040027.1| UL92 [Human herpesvirus 5 strain AD169] 20.970 13.976 1682/2881) gi|52139264|ref|YP_081539.1| protein UL92 [Human herpesvirus 5] 20.970 13.976 1711/2881) gi|52139225|ref|YP_081498.1| membrane glycoprotein UL40 [Human herpesvirus 5] 17.059 13.850 1761/2881) gi|52139304|ref|YP_081579.1| protein UL136 [Human herpesvirus 5] 30.507 13.597 1762/2881) gi|52139339|ref|YP_081614.1| membrane protein US30 [Human herpesvirus 5] 29.007 13.592 1763/2881) gi|9625866|ref|NP_040115.1| US30 [Human herpesvirus 5 strain AD169] 33.907 13.592 1765/2881) gi|9625761|ref|NP_040010.1| UL76 [Human herpesvirus 5 strain AD169] 34.692 13.579 1810/2881) gi|28373232|ref|NP_783809.1| US31 [Human herpesvirus 5 strain AD169] 18.249 13.393 1811/2881) gi|52139340|ref|YP_081615.1| protein US31 [Human herpesvirus 5] 18.249 13.393 1813/2881) gi|28373224|ref|NP_783781.1| GPCR [Human herpesvirus 5 strain AD169] 18.801 13.385 1814/2881) gi|52139219|ref|YP_081492.1| envelope glycoprotein UL33 [Human herpesvirus 5] 13.385 13.385 1824/2881) gi|52139204|ref|YP_081477.1| membrane glycoprotein UL18 [Human herpesvirus 5] 13.368 13.368 1825/2881) gi|9625703|ref|NP_039952.1| UL18 [Human herpesvirus 5 strain AD169] 13.368 13.368 1837/2881) gi|34422128|ref|NP_899644.1| RL1 [Human herpesvirus 5 strain AD169] 45.580 13.318 1838/2881) gi|34422119|ref|NP_899635.1| RL1 [Human herpesvirus 5 strain AD169] 45.580 13.318 1840/2881) gi|52139195|ref|YP_081468.1| protein UL8 [Human herpesvirus 5] 20.855 13.310 1850/2881) gi|52139227|ref|YP_081500.1| protein UL42 [Human herpesvirus 5] 13.261 13.261 1851/2881) gi|28373238|ref|NP_783784.1| UL42 [Human herpesvirus 5 strain AD169] 13.261 13.261 1864/2881) gi|52139183|ref|YP_081456.1| protein RL5A [Human herpesvirus 5] 19.944 13.189 1867/2881) gi|52139213|ref|YP_081486.1| protein UL27 [Human herpesvirus 5] 13.180 13.180 1911/2881) gi|52139226|ref|YP_081499.1| protein UL41A [Human herpesvirus 5] 24.040 12.956 1912/2881) gi|28373249|ref|NP_783783.1| UL41A [Human herpesvirus 5 strain AD169] 24.040 12.956 1943/2881) gi|9625685|ref|NP_039934.1| TRL14 [Human herpesvirus 5 strain AD169] 34.799 12.815 1953/2881) gi|52139285|ref|YP_081560.1| membrane protein UL121 [Human herpesvirus 5] 12.763 12.763 1954/2881) gi|9625809|ref|NP_040058.1| UL121 [Human herpesvirus 5 strain AD169] 12.763 12.763 1960/2881) gi|52139189|ref|YP_081462.1| membrane protein UL1 [Human herpesvirus 5] 12.714 12.714 1973/2881) gi|52139214|ref|YP_081487.1| protein UL28 [Human herpesvirus 5] 12.629 12.629 1974/2881) gi|28373247|ref|NP_783779.1| UL28 [Human herpesvirus 5 strain AD169] 12.629 12.629 1977/2881) gi|52139199|ref|YP_081472.1| protein UL13 [Human herpesvirus 5] 12.607 12.607 1978/2881) gi|9625697|ref|NP_039947.1| UL13 [Human herpesvirus 5 strain AD169] 15.093 12.607 2013/2881) gi|52139223|ref|YP_081496.1| envelope glycoprotein UL37 [Human herpesvirus 5] 23.348 12.408 2014/2881) gi|52139236|ref|YP_081510.1| DNA packaging protein UL33 [Human herpesvirus 5] 12.377 12.377 2015/2881) gi|9625736|ref|NP_039985.1| UL51 [Human herpesvirus 5 strain AD169] 12.377 12.377 2088/2881) gi|9625763|ref|NP_040012.1| UL78 [Human herpesvirus 5 strain AD169] 11.576 11.576 2089/2881) gi|52139251|ref|YP_081526.1| envelope protein UL78 [Human herpesvirus 5] 11.576 11.576 2156/2881) gi|52139250|ref|YP_081525.1| DNA packaging tegument protein UL25 [Human herpesvirus 5] 40.527 10.779 2158/2881) gi|9625790|ref|NP_040040.1| UL105 [Human herpesvirus 5 strain AD169] 22.329 10.704 2159/2881) gi|52139276|ref|YP_081551.1| helicase-primase helicase subunit [Human herpesvirus 5] 22.329 10.704 2176/2881) gi|52139274|ref|YP_081549.1| tegument protein UL7 [Human herpesvirus 5] 13.069 10.469 2177/2881) gi|9625789|ref|NP_040038.1| UL103 [Human herpesvirus 5 strain AD169] 13.069 10.469 2183/2881) gi|9625693|ref|NP_039942.1| UL8 [Human herpesvirus 5 strain AD169] 17.439 10.401 2192/2881) gi|52139231|ref|YP_081504.1| capsid triplex subunit 1 [Human herpesvirus 5] 10.211 10.211 2193/2881) gi|9625731|ref|NP_039980.1| UL46 [Human herpesvirus 5 strain AD169] 10.211 10.211 2208/2881) gi|9625696|ref|NP_039945.1| UL11 [Human herpesvirus 5 strain AD169] 10.093 10.093 2284/2881) gi|9625758|ref|NP_040007.1| UL73 [Human herpesvirus 5 strain AD169] 9.410 9.410 2294/2881) gi|28373248|ref|NP_783780.1| UL31 [Human herpesvirus 5 strain AD169] 9.304 9.304 2295/2881) gi|52139217|ref|YP_081490.1| protein UL31 [Human herpesvirus 5] 9.304 9.304 2306/2881) gi|9625852|ref|NP_040101.1| US16 [Human herpesvirus 5 strain AD169] 9.206 9.206 2307/2881) gi|52139326|ref|YP_081601.1| membrane protein US16 [Human herpesvirus 5] 9.206 9.206 2335/2881) gi|52139283|ref|YP_081558.1| membrane glycoprotein UL119 [Human herpesvirus 5] 9.014 9.014 2336/2881) gi|28373219|ref|NP_783795.1| UL119 [Human herpesvirus 5 strain AD169] 9.014 9.014 2379/2881) gi|9625857|ref|NP_040106.1| US21 [Human herpesvirus 5 strain AD169] 8.723 8.723 2380/2881) gi|52139331|ref|YP_081606.1| membrane protein US21 [Human herpesvirus 5] 8.723 8.723 2397/2881) gi|9625843|ref|NP_040092.1| US7 [Human herpesvirus 5 strain AD169] 8.510 8.510 2416/2881) gi|52139288|ref|YP_081563.1| membrane protein UL124 [Human herpesvirus 5] 8.379 8.379 2417/2881) gi|9625812|ref|NP_040061.1| UL124 [Human herpesvirus 5 strain AD169] 14.212 8.379 2426/2881) gi|52139320|ref|YP_081595.1| membrane glycoprotein US10 [Human herpesvirus 5] 8.318 8.318 2427/2881) gi|9625846|ref|NP_040095.1| US10 [Human herpesvirus 5 strain AD169] 8.318 8.318 2438/2881) gi|52139190|ref|YP_081463.1| protein UL2 [Human herpesvirus 5] 8.179 8.179 2450/2881) gi|9625687|ref|NP_039936.1| UL2 [Human herpesvirus 5 strain AD169] 8.059 8.059 2459/2881) gi|9625759|ref|NP_040008.1| UL74 [Human herpesvirus 5 strain AD169] 16.144 7.999 2469/2881) gi|52139299|ref|YP_081574.1| membrane glycoprotein UL142 [Human herpesvirus 5] 7.978 7.978 2483/2881) gi|52139317|ref|YP_081592.1| membrane glycoprotein US7 [Human herpesvirus 5] 7.819 7.819 2518/2881) gi|52139315|ref|YP_081590.1| membrane glycoprotein US3 [Human herpesvirus 5] 7.560 7.560 2519/2881) gi|9625839|ref|NP_040088.1| US3 [Human herpesvirus 5 strain AD169] 7.560 7.560 2530/2881) gi|52139293|ref|YP_081568.1| membrane protein UL148 [Human herpesvirus 5] 9.639 7.376 2596/2881) gi|9625777|ref|NP_040026.1| UL91 [Human herpesvirus 5 strain AD169] 6.988 6.988 2597/2881) gi|52139263|ref|YP_081538.1| protein UL91 [Human herpesvirus 5] 6.988 6.988 2598/2881) gi|52139291|ref|YP_081566.1| envelope protein UL131A [Human herpesvirus 5] 6.965 6.965 2613/2881) gi|52139321|ref|YP_081596.1| membrane glycoprotein US11 [Human herpesvirus 5] 6.924 6.924 2614/2881) gi|9625847|ref|NP_040096.1| US11 [Human herpesvirus 5 strain AD169] 6.924 6.924 2631/2881) gi|52139282|ref|YP_081557.1| protein UL117 [Human herpesvirus 5] 6.757 6.757 2632/2881) gi|9625805|ref|NP_040054.1| UL117 [Human herpesvirus 5 strain AD169] 6.757 6.757 2656/2881) gi|52139346|ref|YP_081521.1| envelope glycoprotein N [Human herpesvirus 5] 6.466 6.466 2700/2881) gi|9625700|ref|NP_039950.1| UL16 [Human herpesvirus 5 strain AD169] 5.012 5.012 2701/2881) gi|52139202|ref|YP_081475.1| membrane glycoprotein UL16 [Human herpesvirus 5] 5.012 5.012 2711/2881) gi|52139200|ref|YP_081473.1| membrane protein UL14 [Human herpesvirus 5] 9.299 4.760 2722/2881) gi|28373244|ref|NP_783773.1| UL14 [Human herpesvirus 5 strain AD169] 8.299 4.539 2723/2881) gi|52139284|ref|YP_081559.1| membrane protein UL120 [Human herpesvirus 5] 4.525 4.525 2729/2881) gi|52139290|ref|YP_081565.1| envelope glycoprotein UL130 [Human herpesvirus 5] 4.352 4.352 2731/2881) gi|52139280|ref|YP_081555.1| envelope glycoprotein L [Human herpesvirus 5] 4.320 4.320 2732/2881) gi|28373255|ref|NP_783793.1| UL115 [Human herpesvirus 5 strain AD169] 4.320 4.320 2742/2881) gi|9625689|ref|NP_039938.1| UL4 [Human herpesvirus 5 strain AD169] 4.162 4.162 2753/2881) gi|52139201|ref|YP_081474.1| protein UL15A [Human herpesvirus 5] 3.869 3.869 2754/2881) gi|28373236|ref|NP_783774.1| UL15A [Human herpesvirus 5 strain AD169] 3.869 3.869 2807/2881) gi|52139248|ref|YP_081523.1| envelope glycoprotein H [Human herpesvirus 5] 2.792 2.792 2808/2881) gi|52139268|ref|YP_081543.1| tegument protein UL14 [Human herpesvirus 5] 2.714 2.714 2809/2881) gi|28373253|ref|NP_783790.1| UL96 [Human herpesvirus 5 strain AD169] 2.714 2.714 2812/2881) gi|52139252|ref|YP_081527.1| protein UL79 [Human herpesvirus 5] 2.673 2.673 2813/2881) gi|9625764|ref|NP_040013.1| UL79 [Human herpesvirus 5 strain AD169] 2.673 2.673 2828/2881) gi|52139289|ref|YP_081564.1| envelope protein UL128 [Human herpesvirus 5] 3.872 2.482 2829/2881) gi|28373221|ref|NP_783797.1| UL128 [Human herpesvirus 5 strain AD169] 3.872 2.482 2832/2881) gi|52139334|ref|YP_081609.1| tegument protein US24 [Human herpesvirus 5] 2.450 2.450 2833/2881) gi|28373230|ref|NP_783807.1| US24 [Human herpesvirus 5 strain AD169] 2.450 2.450 2843/2881) gi|9625808|ref|NP_040057.1| UL120 [Human herpesvirus 5 strain AD169] 2.405 2.405 2864/2881) gi|9625734|ref|NP_039983.1| UL49 [Human herpesvirus 5 strain AD169] 0.806 0.806 2865/2881) gi|52139235|ref|YP_081508.1| protein UL49 [Human herpesvirus 5] 0.806 0.806 2871/2881) gi|28373254|ref|NP_783792.1| UL111A [Human herpesvirus 5 strain AD169] -0.599 -0.599 2872/2881) gi|52139277|ref|YP_081552.1| interleukin-10 [Human herpesvirus 5] -0.599 -0.599


37/2881) score = 442.534 42.634 (total and max score) >gi|9625710|ref|NP_039959.1| UL25 [Human herpesvirus 5 strain AD169] 1 MSSRRRSSSRRSGEPSTVIYIPSSNEDTPADEEAEDSVFTSTRARSATEDLDRMEAGLSPYSVSSDAPSSFELVRETGGTGAAKKPSEKKRSSSRRQPQI RRSSSRRSGEPSTVI 24.336 (12) DRMEAGLSPYSVSSD 20.953 (59) TGAAKKPSEKKRSSS 16.028 (87) SSRRRSSSRRSGEPS 18.446 (9) FTSTRARSATEDLDR 12.871 (46) SSRRRSSSRRSGEPS 14.762 (9) STRARSATEDLDRME 10.206 (48) MSSRRRSSSRRSGEP 12.435 (8) IPSSNEDTPADEEAE 12.375 (28) MSSRRRSSSRRSGEP 12.203 (8) SSRRRSSSRRSGEPS 6.364 (9) RRSSSRRSGEPSTVI 5.764 (12) MSSRRRSSSRRSGEP 5.684 (8) 101 AAGAPRGSPATPKAGKSPKVSRPPSVPSLPENGAGGGGDDNSSSGGSSSRTTSNSSRSTSPVAPGEPSAAEGDEFSFCDSDIEDFERECYRVSVADNLGF ATPKAGKSPKVSRPP 25.738 (117) TSNSSRSTSPVAPGE 42.634 (159) PKVSRPPSVPSLPEN 19.733 (125) SNSSRSTSPVAPGEP 21.753 (160) AAGAPRGSPATPKAG 18.844 (108) SRTTSNSSRSTSPVA 20.679 (156) AGKSPKVSRPPSVPS 13.959 (121) GSSSRTTSNSSRSTS 17.089 (153) APRGSPATPKAGKSP 13.653 (111) AAEGDEFSFCDSDIE 15.655 (176) APRGSPATPKAGKSP 7.777 (111) DEFSFCDSDIEDFER 13.477 (180) SNSSRSTSPVAPGEP 7.919 (160) SRTTSNSSRSTSPVA 6.893 (156) SNSSRSTSPVAPGEP 2.531 (160) 201 EPSVVAPQHVEYLKFVLQDFDVQHLRRLNECIPMPAFALTSLVDPVLNNVAPGERDLTRRIITHAVIINYYYVAQKKARHMVEAIRTTVRGDTVRRVAAQ 301 VNNQSRSGRAAALALHFLTSRKGVTDGQYATSLRRLDEELRHRGTPESPRLTEVYQTLRDYNVLFYTAHYTSRGALYLYRQNLQRLNENHRGMLRLLSVE RGMLRLLSVEEICEE 15.002 (398) 401 EICEEHTLNDLAFLVGVELMITHFQRTIRVLRCYLQHQLQSISELCYLIYVQLPSLREDYAQLSDVIYWAVSQNYDYALYASTPALFDFLRVVRQQDAFI AVSQNYDYALYASTP 6.769 (477) 501 CTDYVYCALRLLACPDRPIIGDTGGSSSSQRLVGEFMVRDPLLRDPRATHLRQKLITRDICVARLQAQPSSRHIPVEHTGVSSVTLLKIFSQVPPDEREE 601 DTLREMALKAFMEANGNHPEQICRSPPPPLPPRDYPQRDERDRHRRDRRDSGEYCC 38/2881) score = 442.534 42.634 (total and max score) >gi|52139211|ref|YP_081484.1| tegument protein UL25 [Human herpesvirus 5] 1 MSSRRRSSSRRSGEPSTVIYIPSSNEDTPADEEAEDSVFTSTRARSATEDLDRMEAGLSPYSVSSDAPSSFELVRETGGTGAAKKPSEKKRSSSRRQPQI RRSSSRRSGEPSTVI 24.336 (12) DRMEAGLSPYSVSSD 20.953 (59) TGAAKKPSEKKRSSS 16.028 (87) SSRRRSSSRRSGEPS 18.446 (9) FTSTRARSATEDLDR 12.871 (46) SSRRRSSSRRSGEPS 14.762 (9) STRARSATEDLDRME 10.206 (48) MSSRRRSSSRRSGEP 12.435 (8) IPSSNEDTPADEEAE 12.375 (28) MSSRRRSSSRRSGEP 12.203 (8) SSRRRSSSRRSGEPS 6.364 (9) RRSSSRRSGEPSTVI 5.764 (12) MSSRRRSSSRRSGEP 5.684 (8) 101 AAGAPRGSPATPKAGKSPKVSRPPSVPSLPENGAGGGGDDNSSSGGSSSRTTSNSSRSTSPVAPGEPSAAEGDEFSFCDSDIEDFERECYRVSVADNLGF ATPKAGKSPKVSRPP 25.738 (117) TSNSSRSTSPVAPGE 42.634 (159) PKVSRPPSVPSLPEN 19.733 (125) SNSSRSTSPVAPGEP 21.753 (160) AAGAPRGSPATPKAG 18.844 (108) SRTTSNSSRSTSPVA 20.679 (156) AGKSPKVSRPPSVPS 13.959 (121) GSSSRTTSNSSRSTS 17.089 (153) APRGSPATPKAGKSP 13.653 (111) AAEGDEFSFCDSDIE 15.655 (176) APRGSPATPKAGKSP 7.777 (111) DEFSFCDSDIEDFER 13.477 (180) SNSSRSTSPVAPGEP 7.919 (160) SRTTSNSSRSTSPVA 6.893 (156) SNSSRSTSPVAPGEP 2.531 (160) 201 EPSVVAPQHVEYLKFVLQDFDVQHLRRLNECIPMPAFALTSLVDPVLNNVAPGERDLTRRIITHAVIINYYYVAQKKARHMVEAIRTTVRGDTVRRVAAQ 301 VNNQSRSGRAAALALHFLTSRKGVTDGQYATSLRRLDEELRHRGTPESPRLTEVYQTLRDYNVLFYTAHYTSRGALYLYRQNLQRLNENHRGMLRLLSVE RGMLRLLSVEEICEE 15.002 (398) 401 EICEEHTLNDLAFLVGVELMITHFQRTIRVLRCYLQHQLQSISELCYLIYVQLPSLREDYAQLSDVIYWAVSQNYDYALYASTPALFDFLRVVRQQDAFI AVSQNYDYALYASTP 6.769 (477) 501 CTDYVYCALRLLACPDRPIIGDTGGSSSSQRLVGEFMVRDPLLRDPRATHLRQKLITRDICVARLQAQPSSRHIPVEHTGVSSVTLLKIFSQVPPDEREE 601 DTLREMALKAFMEANGNHPEQICRSPPPPLPPRDYPQRDERDRHRRDRRDSGEYCC 56/2881) score = 137.845 37.367 (total and max score) >gi|9625735|ref|NP_039984.1| UL50 [Human herpesvirus 5 strain AD169] 1 MEMNKVLHQDLVQATRRILKLGPSELRVTDAGLICKNPNYSVCDAMLKTDTVYCVEYLLSYWESRTDHVPCFIFKNTGCAVSLCCFVRAPVKLVSPARHV LICKNPNYSVCDAML -1.879 (40) 101 GEFNVLKVNESLIVTLKDIEEIKPSAYGVLTKCVVRKSNSASVFNIELIAFGPENEGEYENLLRELYAKKAASTSLAVRNHVTVSSHSGSGPSLWRARMS GPENEGEYENLLREL 16.361 (159) RNHVTVSSHSGSGPS 15.279 (186) 201 AALTRTAGKRSSRTASPPPPPRHPSCSPTMVAAGGAAAGPRPPPPPMAAGSWRLCRCEACMGRCGCASEGDADEEEEELLALAGEGKAAAAAAGQDVGGS KRSSRTASPPPPPRH 37.367 (216) MGRCGCASEGDADEE 10.065 (268) RTAGKRSSRTASPPP 20.118 (212) KRSSRTASPPPPPRH 8.497 (216) KRSSRTASPPPPPRH 4.817 (216) RTAGKRSSRTASPPP 2.920 (212) 301 ARRPLEEHVSRRRGVSTHHRHPPSPPCAPSLERTGYRWAPSSWWRARSGPSRPQSGPWLPARFATLGPLVLALLLVLALLWRGHGQSSSPTRSAHRD SSWWRARSGPSRPQS 15.948 (348) RGHGQSSSPTRSAHR 8.353 (389) 69/2881) score = 134.756 35.209 (total and max score) >gi|52139237|ref|YP_081509.1| nuclear egress membrane protein [Human herpesvirus 5] 1 MEMNKVLHQDLVQATRRILKLGPSELRVTDAGLICKNPNYSVCDAMLKTDTVYCVEYLLSYWESRTDHVPCFIFKNTGCAVSLCCFVRAPVKLVSPARHV LICKNPNYSVCDAML -1.879 (40) 101 GEFNVLKVNESLIVTLKDIEEIKPSAYGVLTKCVVRKSNSASVFNIELIAFGPENEGEYENLLRELYAKKAASTSLAVRNHVTVSSHSGSGPSLWRARMS GPENEGEYENLLREL 16.361 (159) RNHVTVSSHSGSGPS 15.279 (186) 201 AALTRTAGKRSPRTASPPPPPPRHPSCSPTMVAAGGAAAGPRPPPPPMAAGSWRLCRCEACMGRCGCASEGDADEEEEELLALAGEGKAAAAAAGQDIGG KRSPRTASPPPPPPR 35.209 (216) MGRCGCASEGDADEE 10.065 (269) TRTAGKRSPRTASPP 25.333 (211) KRSPRTASPPPPPPR 5.393 (216) KRSPRTASPPPPPPR 4.694 (216) 301 SARRPLEEHVSRRRGVSTHHRHPPSPPCTPSLERTGYRWAPSSWWRARSGPSRPQSGPWLPARFATLGPLVLALLLVLALLWRGHGQSSSPTRSAHRD SSWWRARSGPSRPQS 15.948 (349) RGHGQSSSPTRSAHR 8.353 (390) 70/2881) score = 297.166 35.207 (total and max score) >gi|9625811|ref|NP_040060.1| IE1 [Human herpesvirus 5 strain AD169] 1 MESSAKRKMDPDNPDEGPSSKVPRPETPVTKATTFLQTMLRKEVNSQLSLGDPLFPELAEESLKTFEQVTEDCNENPEKDVLAELVKQIKVRVDMVRHRI SKVPRPETPVTKATT 13.293 (27) SKVPRPETPVTKATT 5.138 (27) 101 KEHMLKKYTQTEEKFTGAFNMMGGCLQNALDILDKVHEPFEEMKCIGLTMQSMYENYIVPEDKREMWMACIKELHDVSKGAANKLGGALQAKARAKKDEL 201 RRKMMYMCYRNIEFFTKNSAFPKTTNGCSQAMAALQNLPQCSPDEIMAYAQKIFKILDEERDKVLTHIDHIFMDILTTCVETMCNEYKVTSDACMMTMYG 301 GISLLSEFCRVLCCYVLEETSVMLAKRPLITKPEVISVMKRRIEEICMKVFAQYILGADPLRVCSPSVDDLRAIAEESDEEEAIVAYTLATAGVSSSDSL SSSDSLVSPPESPVP 23.004 (402) LRAIAEESDEEEAIV 18.740 (378) SLVSPPESPVPATIP 16.853 (406) LRAIAEESDEEEAIV 12.493 (378) LRAIAEESDEEEAIV 7.254 (378) SLVSPPESPVPATIP 4.803 (406) AGVSSSDSLVSPPES 4.040 (399) 401 VSPPESPVPATIPLSSVIVAENSDQEESEQSDEEEEEGAQEEREDTVSVKSEPVSEIEEVAPEEEEDGAEEPTASGGKSTHPMVTRSKADQ DQEESEQSDEEEEEG 35.207 (431) DQEESEQSDEEEEEG 27.560 (431) DQEESEQSDEEEEEG 25.726 (431) DQEESEQSDEEEEEG 25.099 (431) ENSDQEESEQSDEEE 23.180 (428) EDTVSVKSEPVSEIE 16.232 (451) DQEESEQSDEEEEEG 11.880 (431) SVIVAENSDQEESEQ 11.112 (423) SVKSEPVSEIEEVAP 2.527 (455) DQEESEQSDEEEEEG 8.888 (431) DQEESEQSDEEEEEG 4.138 (431) 106/2881) score = 225.733 32.044 (total and max score) >gi|52139244|ref|YP_081517.1| multifunctional expression regulator [Human herpesvirus 5] 1 MELHSRGRHDAPSLSSLSERERRARRARRFCLDYEPVPRKFRRERSPTSPSTRNGAAASEYHLAEDTVGAASHHHRPCVPARRPRYSKDDDTEGDPDHYP RGRHDAPSLSSLSER 17.357 (13) RKFRRERSPTSPSTR 23.105 (46) TEGDPDHYPPPLPPS 7.561 (99) HDAPSLSSLSERERR 14.542 (16) RKFRRERSPTSPSTR 17.375 (46) RHDAPSLSSLSERER 6.095 (15) RKFRRERSPTSPSTR 14.956 (46) FRRERSPTSPSTRNG 7.087 (48) RRERSPTSPSTRNGA 3.142 (49) 101 PPLPPSSRHALGGTGGHIIMGTAGFRGGHRASSSFKRRVAASASVPLNPHYGKSYDNDDGEPHHHGGDSTHLRRRVPSCPTTFGSSHPSSANNHHGSSAG FRGGHRASSSFKRRV 7.336 (132) SVPLNPHYGKSYDND 6.981 (151) 201 PQQQQMLALIDDELDAMDEDELQQLSRLIEKKKRARLQRGAASSGTSPSSTSPVYDLQRYTAESLRLAPYPADLKVPTAFPQDHQPRGRILLSHDELMHT 301 DYLLHIRQQFDWLEEPLLRKLVVEKIFAVYNAPNLHTLLAIIDETLSYMKYHHLHGLPVNPHDPYLETVGGMRQLLFNKLNNLDLGCILDHQDGWGDHCS 401 TLKRLVKKPGQMSAWLRDDVCDLQKRPPETFSQPMHRAMAYVCSFSRVAVSLRRRALQVTGTPQFFDQFDTNNAMGTYRCGAVSDLILGALQCHECQNEM 501 CELRIQRALAPYRFMIAYCPFDEQSLLDLTVFAGTTTTTASNHATAGGQQRGGDQIHPTDEQCASMESRTDPATLTAYDKKDREGSHRHPSPMIAAAAPP DKKDREGSHRHPSPM 4.020 (586) 601 AQPPSQPQQHYSEGELEEDEDSDDASSQDLVRATDRHGDTVVYKTTAVPPSPPAPLAGVRSHRGELNLMTPSPSHGGSPPQVPHKQPIIPVQSANGNHST ELEEDEDSDDASSQD 32.044 (622) NLMTPSPSHGGSPPQ 16.061 (674) ELEEDEDSDDASSQD 14.922 (622) PSPSHGGSPPQVPHK 5.788 (678) ELEEDEDSDDASSQD 9.684 (622) KTTAVPPSPPAPLAG 2.517 (651) EDSDDASSQDLVRAT 6.547 (627) 701 TATQQQQPPPPPPVPQEDDSVVMRCQTPDYEDMLCYSDDMDD MRCQTPDYEDMLCYS 8.612 (730) 107/2881) score = 233.275 32.044 (total and max score) >gi|9625754|ref|NP_040003.1| UL69 [Human herpesvirus 5 strain AD169] 1 MELHSRGRHDAPSLSSLSERERRARRARRFCLDYEPVPRKFRRERSPTSPSTRNGAAASEHHLAEDTVGAASHHHRPCVPARRPRYSKDDDTEGDPDHYP RGRHDAPSLSSLSER 17.357 (13) RKFRRERSPTSPSTR 23.105 (46) TEGDPDHYPPPLPPS 7.561 (99) HDAPSLSSLSERERR 14.542 (16) RKFRRERSPTSPSTR 17.375 (46) RHDAPSLSSLSERER 6.095 (15) RKFRRERSPTSPSTR 14.956 (46) FRRERSPTSPSTRNG 7.087 (48) RRERSPTSPSTRNGA 3.142 (49) 101 PPLPPSSRHALGGTGGHIIMGTAGFRGGHRASSSFKRRVAASASVPLNPHYGKSYDNDDGEPHHHGGDSTHLRRRVPSCPTTFGSSHPSSANNHHGSSAG FRGGHRASSSFKRRV 7.336 (132) SVPLNPHYGKSYDND 6.981 (151) 201 PQQQQMLALIDDELDAMDEDELQQLSRLIEKKKRARLQRGAASSGTSPSSTSPVYDLQRYTAESLRLAPYPADLKVPTAFPQDHQPRGRILLSHDELMHT 301 DYLLHIRQQFDWLEEPLLRKLVVEKIFAVYNAPNLHTLLAIIDETLSYMKYHHLHGLPVNPHDPYLETVGGMRQLLFNKLNNLDLGCILDHQDGWGDHCS 401 TLKRLVKKPGQMSAWLRDDVCDLQKRPPETFSQPMHRAMAYVCSFSRVAVSLRRRALQVTGTPQFFDQFDTNNAMGTYRCGAVSDLILGALQCHECQNEM 501 CELRIQRALAPYRFMIAYCPFDEQSLLDLTVFAGTTTTTASNHATAGGQQRGGDQIHPTDEQYANMESRTDPATLTAYDKKDREGSHRHPSPMIAAAPPA IHPTDEQYANMESRT 7.542 (563) DKKDREGSHRHPSPM 4.020 (586) 601 QPPSQPQQHYSEGELEEDEDSDDASSQDLVRATDRHGDTVVYKTTAVPPSPPAPLAGVRSHRGELNLMTPSPSHGGSPPQVPHKQPIIPVQSANGNHSTT ELEEDEDSDDASSQD 32.044 (621) NLMTPSPSHGGSPPQ 16.061 (673) ELEEDEDSDDASSQD 14.922 (621) PSPSHGGSPPQVPHK 5.788 (677) ELEEDEDSDDASSQD 9.684 (621) KTTAVPPSPPAPLAG 2.517 (650) EDSDDASSQDLVRAT 6.547 (626) 701 ATQQQQPPPPPPPPPVPQEDDSVVMRCQTPDYEDMLCYSDDMDD MRCQTPDYEDMLCYS 8.612 (732) 138/2881) score = 326.173 30.402 (total and max score) >gi|52139335|ref|YP_081610.1| protein US26 [Human herpesvirus 5] 1 MRQSYRYASGAVVRRTLKGLRKLILCQDLRQDIRHLVRSYADMNISLPVSAPPGWRLDFVEFEDIFGSAAVTDGPETPWGQLICCEESLESLGVLQFSTT 101 VLPRVHGPRSSSEDEDSDDDDFFVYVEEIEPPSQARLVLLLGRYETVWCLDRDCGVLYYLAHSLDDFARHGLLHCEAIYGEQMRTPLLTTQPDHIICDLR SSSEDEDSDDDDFFV 25.333 (117) LLHCEAIYGEQMRTP 11.653 (179) SSSEDEDSDDDDFFV 24.065 (117) PRVHGPRSSSEDEDS 22.354 (110) RVHGPRSSSEDEDSD 20.684 (111) VHGPRSSSEDEDSDD 15.255 (112) SSSEDEDSDDDDFFV 15.092 (117) VHGPRSSSEDEDSDD 14.705 (112) VHGPRSSSEDEDSDD 9.668 (112) 201 LHDNSISELQRVTCRYRGECVPLRTPGEMTRPLLLCGQAENLKGVWPFICMETEQFNDLLKFFVDRLCCETMIMGVVGESLPSGVFHADFVILVDRACEF DRACEFFYFDVSRRE 16.144 (302) 301 FYFDVSRREIWRLADSVDMLLTVGLLKIYQAGRRFHYAVDDAERLEVPGRCPHENFPFWDRFGTVERVRASTRHHELRYKWLIRKDRFIVRPDWCSMRNS 401 LDEVSGTADVSWDPRIRPDYPQTSDLECAKQYWQELNDHVREQTARYGPVRRYSVWCGMSSRLERAVKRLQQRIPRQNLMNPSLMNQGLCVYYSDEEEDQ DQEEDDTSDDDDQEK 30.402 (506) DQEEDDTSDDDDQEK 25.201 (506) EDQEEDDTSDDDDQE 25.190 (505) QGLCVYYSDEEEDQE 12.384 (494) QGLCVYYSDEEEDQE 9.969 (494) QGLCVYYSDEEEDQE 4.295 (494) 501 EEDDTSDDDDQEKETENPQNNIGSLTRTPSSPGSLEGVEERMLNVMKEAVAEQDRKKTQKKHKIDTAQRRVLTRRAARAAVLEGRPTPKPTMPHPVSYLP RTPSSPGSLEGVEER 20.850 (534) GSLTRTPSSPGSLEG 16.417 (530) SLTRTPSSPGSLEGV 6.513 (531) 601 FWM 139/2881) score = 326.173 30.402 (total and max score) >gi|9625862|ref|NP_040111.1| US26 [Human herpesvirus 5 strain AD169] 1 MRQSYRYASGAVVRRTLKGLRKLILCQDLRQDIRHLVRSYADMNISLPISAPPGWRLDFVEFEDIFGSAAVTDGPETPWGQLICCEESLESLGVLQFSTT 101 VLPRVHGPRSSSEDEDSDDDDFFVYVEEIEPPSQARLVLLLGRYETVWCLDRDRGVLYYLAHSLDDFARHGLLHCEAIYGEQMRTPLLTTQPDHIICDLR SSSEDEDSDDDDFFV 25.333 (117) LLHCEAIYGEQMRTP 11.653 (179) SSSEDEDSDDDDFFV 24.065 (117) PRVHGPRSSSEDEDS 22.354 (110) RVHGPRSSSEDEDSD 20.684 (111) VHGPRSSSEDEDSDD 15.255 (112) SSSEDEDSDDDDFFV 15.092 (117) VHGPRSSSEDEDSDD 14.705 (112) VHGPRSSSEDEDSDD 9.668 (112) 201 LHDNSISELQRVTCRYRGECVPLRTPGEMTRPLLLCGQAENLKGVWPFICMETEQFNDLLKFFVDRLCCETMIMGVVGESLPSGVFHADFVILVDRACEF DRACEFFYFDVSRRE 16.144 (302) 301 FYFDVSRREIWRLADSVDMLLTVGLLKIYQAGRRFHYAVDDAERLEVPGRCPHENFPFWDRFGTVERVRASTRHHELRYKWLIRKDRFIVRPDWCSMRNS 401 LDEVSGTADVSWDPRIRPDYPQTSDLECAKQYWQELNDHVREQTARYGPVRRYSVWCGMSSRLERAVKRLQQRIPRQNLMNPSLMNQGLCVYYSDEEEDQ DQEEDDTSDDDDQEK 30.402 (506) DQEEDDTSDDDDQEK 25.201 (506) EDQEEDDTSDDDDQE 25.190 (505) QGLCVYYSDEEEDQE 12.384 (494) QGLCVYYSDEEEDQE 9.969 (494) QGLCVYYSDEEEDQE 4.295 (494) 501 EEDDTSDDDDQEKETENPQNNIGSLTRTPSSPGSLEGVEERMLNVMKEAVAEQDRKKTQKKHKIDTAQRRVLTRRAARAAVLEGRPTPKPTMPHPVSYLP RTPSSPGSLEGVEER 20.850 (534) GSLTRTPSSPGSLEG 16.417 (530) SLTRTPSSPGSLEGV 6.513 (531) 601 FWM 140/2881) score = 127.952 30.345 (total and max score) >gi|52139337|ref|YP_081612.1| envelope protein US28 [Human herpesvirus 5] 1 MTPTTTTAELTTEFDYDEDATPCVFTDVLNQSKPVTLFLYGVVFLFGSIGNFLVIFTITWRRRIQCSGDVYFINLAAADLLFVCTLPLWMQYLLDHNSLA 101 SVPCTLLTACFYVAMFASLCFITEIALDRYYAIVYMRYRPVKQACLFSIFWWIFAVIIAIPHFMVVTKKDNQCMTDYDYLEVSYPIILNVELMLGAFVIP EIALDRYYAIVYMRY 9.789 (131) KKDNQCMTDYDYLEV 12.728 (175) 201 LSVISYCYYRISRIVAVSQSRHKGRIVRVLIAVVLVFIIFWLPYHLTLFVDTLKLLKWISSSCEFERSLKRALILTESLAFCHCCLNPLLYVFVGTKFRQ 301 ELHCLLAEFRQRLFSRDVSWYHSMSFSRRGSPSRRETSSDTLSDEVCRVSQIIP WYHSMSFSRRGSPSR 30.345 (327) GSPSRRETSSDTLSD 22.036 (337) MSFSRRGSPSRRETS 15.932 (331) PSRRETSSDTLSDEV 15.618 (339) MSFSRRGSPSRRETS 9.289 (331) MSFSRRGSPSRRETS 5.284 (331) EFRQRLFSRDVSWYH 4.266 (315) MSFSRRGSPSRRETS 2.666 (331) 161/2881) score = 105.986 29.702 (total and max score) >gi|9625836|ref|NP_040085.1| IRS1 [Human herpesvirus 5 strain AD169] 1 MAQRNGMSPRPPPLGRGRGAGGPSGVGSSPPSSCVPMGAPSTAGTGASAAATTTPGHGVHRVEPRGPPGAPPSSGNNSNFWHGPERLLLSQIPVERQALT 101 ELEYQAMGAVWRAAFLANSTGRAMRKWSQRDAGTLLPLGRPYGFYARVTPRSQMNGVGATDLRQLSPRDAWIVLVATVVHEVDPAADPTVGDKAGHPEGL 201 CAQDGLYLALGAGFRVFVYDLANNTLILAARDADEWFRHGAGEVVRLYRCNRLGVGTPRATLLPQPALRQTLLRAEEATALGRELRRRWAGTTVALQTPG 301 RRLQPMVLLGAWQELAQYEPFASAPHPASLLTAVRRHLNQRLCCGWLALGAVLPARWLGCAAGPATGTAAGTTSPPAASGTETEAAGGDAPCAIAGAVGS GTAAGTTSPPAASGT 18.491 (374) 401 AVPVPPQPYGAAGGGAICVPNADAHAVVGADAAAAAAPTVMVGSTAMAGPAASGTVPRAMLVVLLDELGAVFGYCPLDGHVYPLAAELSHFLRAGVLGAL 501 ALGRESAPAAEAARRLLPELDREQWERPRWDALHLHPRAALWAREPHGQWEFMFREQRGDPINDPLAFRLSDARTLGLDLTTVMTERQSQLPEKYIGFYQ 601 IRKPPWLMEQPPPPSRQTKPDAATMPPPLSAQASVSYALRYDDESWRPLSTVDDHKAWLDLDESHWVLGDSRPDDIKQRRLLKATQRRGAEIDRPMPVVP PVVPEECYDQRFTTE 13.884 (704) 701 EECYDQRFTTEGHQVIPLCASEPEDDDEDPTYDELPSRPPQKHKPPDKPPRLCKTGPGPPPLPPKQRHGSTDGKVSAPRQSEHHKRQTRPPRPPPPKFGD DDDEDPTYDELPSRP 29.702 (732) PPKQRHGSTDGKVSA 12.709 (770) DRTAAHLSQNMRDMY 12.216 (807) DDDEDPTYDELPSRP 7.656 (732) QVIPLCASEPEDDDE 6.404 (721) QVIPLCASEPEDDDE 4.925 (721) 801 RTAAHLSQNMRDMYLDMCTSSGHRPRPPAPPRPKKCQTHAPHHVHH 162/2881) score = 105.205 29.702 (total and max score) >gi|52139312|ref|YP_081587.1| tegument protein IRS1 [Human herpesvirus 5] 1 MAQRNGMSPRPPPLGRGRGAGGPSGVGSSPPSSCVPMGATSTAGTGASAAPTATPGHGVHRVEPRGPPGAPPSSGNNSNFWHGPERLLLSQIPVERQALT 101 ELEYQAMGAVWRAAFLANSTGRAMRKWSQRDAGTLLPLGRPYGFYARVTPRSQMNGVGATDLRQLSPRDAWIVLVATVVHEVDPAADPTVGDKAGHPEGL 201 CAQDGLYLALGAGFRVFVYDLANNTLILAARDADEWFRHGAGEVVRLYRCNRLGVGTPRATLLPQPALRQTLLRAEEATALGRELRRRWAGTTVALQTPG 301 RRLQPMVLLGAWQELAQYEPFASAPHPASLLTAVRRHLNQRLCCGWLALGAVLPARWLGCAAGPATGTTSPPAASGTETEAAGGDAPCAMAGAVGSAVTI GPATGTTSPPAASGT 17.710 (370) 401 PPQPYGGAGGSAICVPNADAHAVVGADATAAAAAAAAAPTVMVGPTAMAGPAASGTVPRAMLVVVLDELGAVFGYCPLDGHVYPLAAELSHFLRAGVLGA 501 LALGRESAPAAEAARRLLPELDREQWERPRWDALHLHPRAALWAREPHGQWEFMFREQRGDPIHDPVAFRLSDARTLGLDLTTVMTERQSQLPEKYIGFY 601 QIRKPPWLMEQPPPPSRQTKPDAATMPPPLSAQASVSYALRYDDESWRPLSTVDDHKAWLDLDESHWVLGDSRPDDIKQRRLLKATQRRGAEIDRPMPVV PVVPEECYDQRFTTE 13.884 (705) 701 PEECYDQRFTTEGHQVIPLCASEPEDDDEDPTYDELPSRPPQKHKPPDKPPRLCKTGPGPPPLPPKQRHGSTDGKVSAPRQSEHHKRQTRPPRPPPPKFG DDDEDPTYDELPSRP 29.702 (733) PPKQRHGSTDGKVSA 12.709 (771) DDDEDPTYDELPSRP 7.656 (733) QVIPLCASEPEDDDE 6.404 (722) QVIPLCASEPEDDDE 4.925 (722) 801 DRTAAHLSQNMRDMYLDMCTSSGHRPRPPAPPRPKKCQTHAPHHVHH DRTAAHLSQNMRDMY 12.216 (808) 174/2881) score = 116.852 29.408 (total and max score) >gi|9625844|ref|NP_040093.1| US8 [Human herpesvirus 5 strain AD169] 1 MRRWLRLLVGLGCCWVTLAHAGNPYEDDDYYYYREDEPRQHGEPNYVAPPARQFRFPPLNNVSSYQASCVVKDGVLDAVWRVQGTFYPEKGIVARVGWSG NPYEDDDYYYYREDE 29.408 (30) RQHGEPNYVAPPARQ 26.506 (46) PYEDDDYYYYREDEP 14.386 (31) YEDDDYYYYREDEPR 10.742 (32) EDDDYYYYREDEPRQ 10.382 (33) NPYEDDDYYYYREDE 9.594 (30) YEDDDYYYYREDEPR 8.096 (32) RQHGEPNYVAPPARQ 7.737 (46) 101 RRGRKWGRLHAPECLVETTEAVFRLRQWVPTDLDHLTLHLVPCTKCKPMWCQPRYHIRYFSYGNSVDNLRRLHYEYRHLELGVVIAICMAMVLLLGYVLA 201 RTVYRVSSAYYLRWHACVPQKCEKSLC 175/2881) score = 116.852 29.408 (total and max score) >gi|52139318|ref|YP_081593.1| membrane glycoprotein US8 [Human herpesvirus 5] 1 MRRWLRLLVGLGCCWVTLAHAGNPYEDDDYYYYREDEPRQHGEPNYVAPPARQFRFPPLNNVSSYQASCVVKDGVLDAVWRVQGTFYPEKGIVARVGWSG NPYEDDDYYYYREDE 29.408 (30) RQHGEPNYVAPPARQ 26.506 (46) PYEDDDYYYYREDEP 14.386 (31) YEDDDYYYYREDEPR 10.742 (32) EDDDYYYYREDEPRQ 10.382 (33) NPYEDDDYYYYREDE 9.594 (30) YEDDDYYYYREDEPR 8.096 (32) RQHGEPNYVAPPARQ 7.737 (46) 101 RRGRKWGRLHAPECLVETTEAVFRLRQWVPTDLDHLTLHLVPCTKCKPMWCQPRYHIRYFSYGNSVDNLRRLHYEYRHLELGVVIAIQMAMVLLLGYVLA 201 RTVYRVSSAYYLRWHACVPQKCEKSLC 180/2881) score = 450.765 29.258 (total and max score) >gi|28373220|ref|NP_783796.1| IE2 [Human herpesvirus 5 strain AD169] 1 MESSAKRKMDPDNPDEGPSSKVPRPETPVTKATTFLQTMLRKEVNSQLSLGDPLFPELAEESLKTFEQVTEDCNENPEKDVLAELGDILAQAVNHAGIDS SKVPRPETPVTKATT 13.293 (27) SKVPRPETPVTKATT 5.138 (27) 101 SSTGPTLTTHSCSVSSAPLNKPTPTSVAVTNTPLPGASATPELSPRKKPRKTTRPFKVIIKPPVPPAPIMLPLIKQEDIKPEPDFTIQYRNKIIDTAGCI ASATPELSPRKKPRK 21.934 (144) GCIVISDSEEEQGEE 10.465 (205) PLPGASATPELSPRK 14.996 (140) GCIVISDSEEEQGEE 8.987 (205) ASATPELSPRKKPRK 14.619 (144) TAGCIVISDSEEEQG 6.768 (203) ASATPELSPRKKPRK 6.820 (144) TAGCIVISDSEEEQG 5.563 (203) TAGCIVISDSEEEQG 4.264 (203) 201 VISDSEEEQGEEVETRGATASSPSTGSGTPRVTSPTHPLSQMNHPPLPDPLGRPDEDSSSSSSSSCSSASDSESESEEMKCSSGGGASVTSSHHGRGGFG SSSSSCSSASDSESE 29.258 (268) SCSSASDSESESEEM 27.990 (272) SSSCSSASDSESESE 26.540 (270) SCSSASDSESESEEM 22.543 (272) SSASDSESESEEMKC 17.448 (274) LGRPDEDSSSSSSSS 17.351 (258) RPDEDSSSSSSSSCS 17.019 (260) SSSCSSASDSESESE 17.017 (270) SCSSASDSESESEEM 16.224 (272) SSSSSCSSASDSESE 15.200 (268) ASDSESESEEMKCSS 15.087 (276) SSASDSESESEEMKC 14.469 (274) GRPDEDSSSSSSSSC 14.203 (259) SSSCSSASDSESESE 13.852 (270) SSSCSSASDSESESE 13.492 (270) DEDSSSSSSSSCSSA 13.192 (262) SCSSASDSESESEEM 5.449 (272) SSSCSSASDSESESE 4.238 (270) SSSSSSCSSASDSES 3.369 (267) 301 GAASSSLLSCGHQSSGGASTGPRKKKSKRISELDNEKVRNIMKDKNTPFCTPNVQTRRGRVKIDEVSRMFRNTNRSLEYKNLPFTIPSMHQVLDEAIKAC DKNTPFCTPNVQTRR 22.527 (351) KKKSKRISELDNEKV 2.761 (331) 401 KTMQVNNKGIQIIYTRNHEVKSEVDAVRCRLGTMCNLALSTPFLMEHTMPVTHPPEVAQRTADACNEGVKAAWSLKELHTHQLCPRSSDYRNMIIHAATP 501 VDLLGALNLCLPLMQKFPKQVMVRIFSTNQGGFMLPIYETAAKAYAVGQFEQPTETPPEDLDTLSLAIEAAIQDLRNKSQ GGFMLPIYETAAKAY 8.687 (538) 181/2881) score = 453.585 29.258 (total and max score) >gi|52139286|ref|YP_081561.1| regulatory protein IE2 [Human herpesvirus 5] 1 MESSAKRKMDPDNPDEGPSSKVPRPETPVTKATTFLQTMLRKEVNSQLSLGDPLFPELAEESLKTFEQVTEDCNENPEKDVLTELGDILAQAVNHAGIDS SKVPRPETPVTKATT 13.293 (27) SKVPRPETPVTKATT 5.138 (27) 101 SSTGPTLTTHSCSVSSAPLNKPTPTSVAVTNTPLPGASATPELSPRKKPRKTTRPFKVIIKPPVPPAPIMLPLIKQEDIKPEPDFTIQYRNKIIDTAGCI ASATPELSPRKKPRK 21.934 (144) GCIVISDSEEEQGEE 10.465 (205) PLPGASATPELSPRK 14.996 (140) GCIVISDSEEEQGEE 8.987 (205) ASATPELSPRKKPRK 14.619 (144) TAGCIVISDSEEEQG 6.768 (203) ASATPELSPRKKPRK 6.820 (144) TAGCIVISDSEEEQG 5.563 (203) TAGCIVISDSEEEQG 4.264 (203) 201 VISDSEEEQGEEVETRGATASSPSTGSGTPRVTSPTHPLSQMNHPPLPDPLGRPDEDSSSSSSSSCSSASDSESESEEMKCSSGGGASVTSSHHGRGGFG SSSSSCSSASDSESE 29.258 (268) SCSSASDSESESEEM 27.990 (272) SSSCSSASDSESESE 26.540 (270) SCSSASDSESESEEM 22.543 (272) SSASDSESESEEMKC 17.448 (274) LGRPDEDSSSSSSSS 17.351 (258) RPDEDSSSSSSSSCS 17.019 (260) SSSCSSASDSESESE 17.017 (270) SCSSASDSESESEEM 16.224 (272) SSSSSCSSASDSESE 15.200 (268) ASDSESESEEMKCSS 15.087 (276) SSASDSESESEEMKC 14.469 (274) GRPDEDSSSSSSSSC 14.203 (259) SSSCSSASDSESESE 13.852 (270) SSSCSSASDSESESE 13.492 (270) DEDSSSSSSSSCSSA 13.192 (262) SCSSASDSESESEEM 5.449 (272) SSSCSSASDSESESE 4.238 (270) SSSSSSCSSASDSES 3.369 (267) 301 GAASSSLLSCGHQSSGGASTGPRKKKSKRISELDNEKVRNIMKDKNTPFCTPNVQTRRGRVKIDEVSRMFRHTNRSLEYKNLPFMIPSMHQVLEEAIKVC DKNTPFCTPNVQTRR 22.527 (351) KKKSKRISELDNEKV 2.761 (331) 401 KTMQVNNKGIQIIYTRNHEVKNEVDQVRCRLGSMCNLALSTPFLMEHTMPVTHPPDVAQRTADACNDGVKAVWNLKELHTHQLCPRSSDYRNMIIHAATP 501 VDLLGALNLCLPLMQKFPKQVMVRIFSTNQGGFMLPIYETAAKAYAVGQFEKPTETPPEDLDTLSLAIEAAIQDLRNKSQ GGFMLPIYETAAKAY 8.687 (538) QFEKPTETPPEDLDT 2.820 (556) 186/2881) score = 181.139 29.129 (total and max score) >gi|52139301|ref|YP_081576.1| protein UL140 [Human herpesvirus 5] 1 MTPAQTNGTTTVHPHGAKNGSGGSALPTLVVFGFIVTLLFFLFMLYFWNNDVFRKLLRCAWIQRCCDRFDAWQDEVIYRRPSRRSQSDDESRTNSVSSYV YRRPSRRSQSDDESR 29.129 (85) YRRPSRRSQSDDESR 23.708 (85) RPSRRSQSDDESRTN 18.308 (87) YRRPSRRSQSDDESR 17.449 (85) AWQDEVIYRRPSRRS 17.132 (78) RSQSDDESRTNSVSS 15.191 (91) RPSRRSQSDDESRTN 15.156 (87) YRRPSRRSQSDDESR 14.515 (85) RPSRRSQSDDESRTN 12.091 (87) AWQDEVIYRRPSRRS 7.658 (78) RPSRRSQSDDESRTN 4.896 (87) YRRPSRRSQSDDESR 3.246 (85) SRTNSVSSYVLLSPA 2.659 (98) 101 LLSPASDGGFDNPALTEAVDSVDDWATTSVFYATSDETADTERRDSQQLLIELPPEPLPPDVVAAMQKAVKRAVQNALRHSHDSWQLHQTL 204/2881) score = 205.307 28.669 (total and max score) >gi|9625720|ref|NP_039969.1| UL35 [Human herpesvirus 5 strain AD169] 1 MAQGSRAPSGPPLPVLPVDDWLNFRVDLFGDEHRRLLLEMLTQGCSNFVGLLNFGVPSPVYALEALVDFQVRNAFMKVKPVAQEIIRICILANHYRNSRD 101 VLRDLRTQLDVLYSDPLKTRLLRGLIRLCRAAQTGVKPEDISVHLGADDVTFGVLKRALVRLHRVRDALGLRASPEAEARYPRLTTYNLLFHPPPFTTVE RTQLDVLYSDPLKTR 15.043 (113) DALGLRASPEAEARY 14.219 (174) 201 AVDLCAENLSDVTQRRNRPLRCLTSIKRPGSRTLEDALNDMYLLLTLRHLQLRHALELQMMQDWVVERCNRLCDALYFCYTQAPETRQTFVTLVRGLELA TSIKRPGSRTLEDAL 13.978 (231) 301 RQHSSPAFQPMLYNLLQLLTQLHEANVYLCPGYLHFSAYKLLKKIQSVSDARERGEFGDEDEEQENDGEPREAQLDLEADPTAREGELFFFSKNLYGNGE KLLKKIQSVSDARER 17.234 (347) 401 VFRVPEQPSRYLRRRMFVERPETLQIFYNFHEGKITTETYHLQRIYSMMIEGASRQTGLTPKRFMELLDRAPLGQESEPEITEHRDLFADVFRRPVTDAA RAPLGQESEPEITEH 12.585 (477) 501 SSSSASSSSSSASPNSVSLPSARSSSTRTTTPASTYTSAGTSSTTGLLLSSSLSGSHGISSADLEQPPRQRRRMVSVTLFSPYSVAYSHHRRHRRRRSPP SSSASSSSSSASPNS 19.734 (509) RRHRRRRSPPPAPRG 28.669 (598) SSSSSSASPNSVSLP 13.195 (513) RRHRRRRSPPPAPRG 12.392 (598) SSSTRTTTPASTYTS 12.973 (531) RRHRRRRSPPPAPRG 12.340 (598) RRHRRRRSPPPAPRG 9.500 (598) RRHRRRRSPPPAPRG 7.351 (598) RQRRRMVSVTLFSPY 3.913 (576) 601 PAPRGPAHTRFQGPDSMPSTSYGSDVEDPRDDLAENLRHL PDSMPSTSYGSDVED 7.751 (621) MPSTSYGSDVEDPRD 4.431 (624) 205/2881) score = 205.869 28.669 (total and max score) >gi|52139221|ref|YP_081494.1| tegument protein UL35 [Human herpesvirus 5] 1 MAQGSRAPSGPPLPVLPVDDWLNFRVDLFGDEHRRLLLEMLTQGCSNFVGLLNFGVPSPVYALEALVDFQVRNAFMKVKPVAQEIIRICILANHYRNSRD 101 VLRDLRTQLDVLYSEPLKTRLLRGLIRLCRAAQTGVKPEDISVHLGADDVTFGVLKRALVRLHRVRDALGLRASPEAEARYPRLTTYNLLFHPPPFTTVE RTQLDVLYSEPLKTR 15.605 (113) DALGLRASPEAEARY 14.219 (174) 201 AVDLCAENLSDVTQRRNRPLRCLTSIKRPGSRTLEDALNDMYLLLTLRHLQLRHALELQMMQDWVVERCNRLCDALYFCYTQAPETRQTFVTLVRGLELA TSIKRPGSRTLEDAL 13.978 (231) 301 RQHSSPAFQPMLYNLLQLLTQLHEANVYLCPGYLHFSAYKLLKKIQSVSDARERGEFGDEDEEQENDGEPREAQLDLEADPTAREGELFFFSKNLYGNGE KLLKKIQSVSDARER 17.234 (347) 401 VFRVPEQPSRYLRRRMFVERPETLQIFYNFHEGKITTETYHLQRIYSMMIEGASRQTGLTPKRFMELLDRAPLGQESEPEITEHRDLFADVFRRPVTDAA RAPLGQESEPEITEH 12.585 (477) 501 SSSSASSSSSSASPNSVSLPSARSSSTRTTTPASTYTSAGTSSTTGLLLSSSSLSGSHGISSADLEQPPRQRRRMVSVTLFSPYSVAYSHHRRHRRRRSP SSSASSSSSSASPNS 19.734 (509) RRHRRRRSPPPAPRG 28.669 (599) SSSSSSASPNSVSLP 13.195 (513) RRHRRRRSPPPAPRG 12.392 (599) SSSTRTTTPASTYTS 12.973 (531) RRHRRRRSPPPAPRG 12.340 (599) RRHRRRRSPPPAPRG 9.500 (599) RRHRRRRSPPPAPRG 7.351 (599) RQRRRMVSVTLFSPY 3.913 (577) 601 PPAPRGPAHTRFQGPDSMPSTSYGSDVEDPRDDLAENLRHL PDSMPSTSYGSDVED 7.751 (622) MPSTSYGSDVEDPRD 4.431 (625) 206/2881) score = 52.966 28.582 (total and max score) >gi|9625848|ref|NP_040097.1| US12 [Human herpesvirus 5 strain AD169] 1 MVQIQFHQGEPLGHKKEKPPPVSPPSPPPIRRVTVITKDEDTLRSVQHFLWMVRLYGTVVFQTSATIATTILFMLIPWRVTAPYLRDTLPFWSTLLPCAL KEKPPPVSPPSPPPI 28.582 (23) PPPVSPPSPPPIRRV 12.345 (26) KEKPPPVSPPSPPPI 8.805 (23) 101 RCHAYWLERRRRPGTLMLVMVYTTLTTISVSTIGLCFDRTVVIQAYVLSSMLCVWCTGLAWLMAWNMQRRLAILCLLSFMLPILWLFIAVQSWEPYQRII 201 LALTVSFIYGLKIVLIRDTLTVLYRSPSNCYTDGDLLRTAMLLYMDQVIMFLLVVVPLTAPIWYPNYAGALGRTAHWLFHK TVLYRSPSNCYTDGD 3.233 (228) 207/2881) score = 52.966 28.582 (total and max score) >gi|52139322|ref|YP_081597.1| membrane protein US12 [Human herpesvirus 5] 1 MVQIQFHQGEPLGHKKEKPPPVSPPSPPPIRRVTVITKDEDTLRSVQHFLWMVRLYGTVVFQTSATIATTILFMLIPWRVTTPYLRDTLPFWSTLLPCAL KEKPPPVSPPSPPPI 28.582 (23) PPPVSPPSPPPIRRV 12.345 (26) KEKPPPVSPPSPPPI 8.805 (23) 101 RCHAYWLERQRRPGTLMLVMVYTTLTTISVSTIGLCFDRTVVIQAYVLSSMLCVWCTGLAWLMAWNMQRRLAILCLLSFMLPILWLFIAVQSWEPYQRII 201 LALTVSFIYGLKIVLIRDTLTVLYRSPSNCYTDGDLLRTAMLLYMDQVIMFLLVVVPLTAPIWYPNYAGALGRTAHWLFHK TVLYRSPSNCYTDGD 3.233 (228) 263/2881) score = 92.634 26.954 (total and max score) >gi|9625820|ref|NP_040069.1| UL132 [Human herpesvirus 5 strain AD169] 1 MPAPRGLLRATFLVLVAFGLLLHIDFSDATNMTSSTNVPTSTSSRNTVESTTSSEPTTETNMTTARESSVHDARNDEIMKVLAILFYIVTGTSIFSFIAV 101 LIAVVYSSCCKHPGRFRFADEEAVNLLDDTDDSGGSSPFGSGSRRGSQIPAGFCSSSPYQRLETRDWDEEEEASAARERMKHDPENVIYFRKDGNLDTSF TDDSGGSSPFGSGSR 26.954 (137) TSFVNPNYGRGSPLT 1.127 (205) SSPFGSGSRRGSQIP 23.420 (143) TDDSGGSSPFGSGSR 12.536 (137) GSGSRRGSQIPAGFC 2.508 (147) 201 VNPNYGRGSPLTIESHLSDNEEDPIRYYVSVYDELTASEMEEPSNSTSWQIPKLMKVAMQPVSLRDPEYD LTIESHLSDNEEDPI 7.698 (218) GSPLTIESHLSDNEE 7.413 (215) LTIESHLSDNEEDPI 6.320 (218) VYDELTASEMEEPSN 4.659 (238) 264/2881) score = 92.634 26.954 (total and max score) >gi|52139292|ref|YP_081567.1| envelope glycoprotein UL132 [Human herpesvirus 5] 1 MPAPRGPLRATFLALVAFGLLLQIDLSDVTNVTSSTKVPTSTSNRNSVDNATSSGPTTGINMTTTHESSVHNVRNNEIMKVLAILFYIVTGTSIFSFIAV 101 LVAVVYSSCCKHPGRFRFADEEAVNLLDDTDDSGGSSPFGSGSRRGSQIPAGFCSSSPYQRLETRDWDEEEEASAARERMKHDPENVIYFRKDGNLDTSF TDDSGGSSPFGSGSR 26.954 (137) TSFVNPNYGRGSPLT 1.127 (205) SSPFGSGSRRGSQIP 23.420 (143) TDDSGGSSPFGSGSR 12.536 (137) GSGSRRGSQIPAGFC 2.508 (147) 201 VNPNYGRGSPLTIESHLSDNEEDPIRYYVSVYDELTASEMEEPSNSTSWQIPKLMKVAMQPVSLRDPEYD LTIESHLSDNEEDPI 7.698 (218) GSPLTIESHLSDNEE 7.413 (215) LTIESHLSDNEEDPI 6.320 (218) VYDELTASEMEEPSN 4.659 (238) 266/2881) score = 209.984 26.877 (total and max score) >gi|52139254|ref|YP_081529.1| capsid scaffold protein [Human herpesvirus 5] 1 MSHPLSAAVPAATAPPGATVAGASPAVSSLAWPHDGVYLPKDAFFSLLGASRSAAPVMYPGAVAAPPSASPAPLPLPSYPASYGAPVVGYDQLAARHFAD 101 YVDPHYPGWGRRYEPAPSLHPSYPVPPPPSPAYYRRRDSPGGMDEPPSGWERYDGGHRGQSQKQHRHGGSGGHNKRRKETAAASSSSSDEDLSFPGEAEH AYYRRRDSPGGMDEP 18.281 (139) RKETAAASSSSSDED 26.877 (184) AYYRRRDSPGGMDEP 9.612 (139) RKETAAASSSSSDED 19.767 (184) AYYRRRDSPGGMDEP 2.941 (139) ETAAASSSSSDEDLS 15.564 (186) TAAASSSSSDEDLSF 14.766 (187) KETAAASSSSSDEDL 13.525 (185) RKETAAASSSSSDED 8.991 (184) AAASSSSSDEDLSFP 3.031 (188) 201 GRARKRLKSHVNSDGGSGGHAGSNQQQQQRYDELRDAIHELKRDLFAARQSSTLLSAALPSAASSSPTTTTVCTPTSELTSGGGETPTALLSGGAKVAER RLKSHVNSDGGSGGH 17.444 (213) PTTTTVCTPTSELTS 15.618 (274) RARKRLKSHVNSDGG 17.119 (209) RARKRLKSHVNSDGG 5.214 (209) 301 AQAGVVNASCRLATASGSEAATAGPSTAGSSSCPASVVLAAAAAQAAAASQSPPKDMVDLNRRIFVAALNKLE AAQAAAASQSPPKDM 17.412 (350) QAAAASQSPPKDMVD 3.822 (352) 267/2881) score = 348.113 26.877 (total and max score) >gi|52139253|ref|YP_081528.1| capsid maturation protease [Human herpesvirus 5] 1 MTMDEQQSQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLHAQGQGQPSLSVALPLNINHDDTAVVGHVAAMQSVRDGLFCLGCVTSPRFLEIVRRA VGGFLARYDQSPDEA 8.858 (23) FLARYDQSPDEAELL 4.851 (26) 101 SEKSELVSRGPVSPLQPDKVVEFLSGSYAGLSLSSRRCDDVEAATSLSGSETTPFKHVALCSVGRRRGTLAVYGRDPEWVTQRFPDLTAADRDGLRAQWQ LVSRGPVSPLQPDKV 5.901 (113) DDVEAATSLSGSETT 17.233 (146) LVSRGPVSPLQPDKV 2.477 (113) 201 RCGSTAVDASGDPFRSDSYGLLGNSVDALYIRERLPKLRYDKQLVGVTERESYVKASVSPEAACVIKAASAERSGDSRSQAATPAAGARVPSSSPSPPVE GDPFRSDSYGLLGNS 2.558 (218) GARVPSSSPSPPVEP 23.382 (294) RVPSSSPSPPVEPPS 22.627 (296) GARVPSSSPSPPVEP 18.016 (294) DSRSQAATPAAGARV 16.431 (283) 301 PPSPVQPPALPASPSVLPAESPPSLSPSEPAEAASMSHPLSAAVPAATAPPGATVAGASPAVSSLAWPHDGVYLPKDAFFSLLGASRSAAPVMYPGAVAA AESPPSLSPSEPAEA 15.795 (326) 401 PPSASPAPLPLPSYPASYGAPVVGYDQLAARHFADYVDPHYPGWGRRYEPAPSLHPSYPVPPPPSPAYYRRRDSPGGMDEPPSGWERYDGGHRGQSQKQH AYYRRRDSPGGMDEP 18.281 (474) AYYRRRDSPGGMDEP 9.612 (474) AYYRRRDSPGGMDEP 2.941 (474) 501 RHGGSGGHNKRRKETAAASSSSSDEDLSFPGEAEHGRARKRLKSHVNSDGGSGGHAGSNQQQQQRYDELRDAIHELKRDLFAARQSSTLLSAALPSAASS RKETAAASSSSSDED 26.877 (519) RLKSHVNSDGGSGGH 17.444 (548) RKETAAASSSSSDED 19.767 (519) RARKRLKSHVNSDGG 17.119 (544) ETAAASSSSSDEDLS 15.564 (521) TAAASSSSSDEDLSF 14.766 (522) KETAAASSSSSDEDL 13.525 (520) RKETAAASSSSSDED 8.991 (519) RARKRLKSHVNSDGG 5.214 (544) AAASSSSSDEDLSFP 3.031 (523) 601 SPTTTTVCTPTSELTSGGGETPTALLSGGAKVAERAQAGVVNASCRLATASGSEAATAGPSTAGSSSCPASVVLAAAAAQAAAASQSPPKDMVDLNRRIF PTTTTVCTPTSELTS 15.618 (609) AAQAAAASQSPPKDM 17.412 (685) QAAAASQSPPKDMVD 3.822 (687) 701 VAALNKLE 268/2881) score = 194.366 26.877 (total and max score) >gi|9625766|ref|NP_040015.1| UL80.5 [Human herpesvirus 5 strain AD169] 1 MSHPLSAAVPAATAPPGATVAGASPAVSSLAWPHDGVYLPKDAFFSLLGASRSAVPVMYPGAVAAPPSASPAPLPLPSYPASYGAPVVGYDQLAARHFAD 101 YVDPHYPGWGRRYEPAPSLHPSYPVPPPPSPAYYRRRDSPGGMDEPPSGWERYDGGHRGQSQKQHRHGGSGGHNKRRKETAAASSSSSDEDLSFPGEAEH AYYRRRDSPGGMDEP 18.281 (139) RKETAAASSSSSDED 26.877 (184) AYYRRRDSPGGMDEP 9.612 (139) RKETAAASSSSSDED 19.767 (184) AYYRRRDSPGGMDEP 2.941 (139) ETAAASSSSSDEDLS 15.564 (186) TAAASSSSSDEDLSF 14.766 (187) KETAAASSSSSDEDL 13.525 (185) RKETAAASSSSSDED 8.991 (184) AAASSSSSDEDLSFP 3.031 (188) 201 GRARKRLKSHVNSDGGSGGHAGSNQQQQQRYDELRDAIHELKRDLFAARQSSTLLSAALPSAASSSPTTTTVCTPTGELTSGGGETPTALLSGGAKVAER RLKSHVNSDGGSGGH 17.444 (213) RARKRLKSHVNSDGG 17.119 (209) RARKRLKSHVNSDGG 5.214 (209) 301 AQAGVVNASCRLATASGSEAATAGPSTAGSSSCPASVVLAAAAAQAAAASQSPPKDMVDLNRRIFVAALNKLE AAQAAAASQSPPKDM 17.412 (350) QAAAASQSPPKDMVD 3.822 (352) 269/2881) score = 332.495 26.877 (total and max score) >gi|9625765|ref|NP_040014.1| UL80 [Human herpesvirus 5 strain AD169] 1 MTMDEQQSQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLHAQGQGQPSLSVALPLNINHDDTAVVGHVAAMQSVRDGLFCLGCVTSPRFLEIVRRA VGGFLARYDQSPDEA 8.858 (23) FLARYDQSPDEAELL 4.851 (26) 101 SEKSELVSRGPVSPLQPDKVVEFLSGSYAGLSLSSRRCDDVEAATSLSGSETTPFKHVALCSVGRRRGTLAVYGRDPEWVTQRFPDLTAADRDGLRAQWQ LVSRGPVSPLQPDKV 5.901 (113) DDVEAATSLSGSETT 17.233 (146) LVSRGPVSPLQPDKV 2.477 (113) 201 RCGSTAVDASGDPFRSDSYGLLGNSVDALYIRERLPKLRYDKQLVGVTERESYVKASVSPEAACDIKAASAERSGDSRSQAATPAAGARVPSSSPSPPVE GDPFRSDSYGLLGNS 2.558 (218) GARVPSSSPSPPVEP 23.382 (294) RVPSSSPSPPVEPPS 22.627 (296) GARVPSSSPSPPVEP 18.016 (294) DSRSQAATPAAGARV 16.431 (283) 301 PPSPVQPPALPASPSVLPAESPPSLSPSEPAEAASMSHPLSAAVPAATAPPGATVAGASPAVSSLAWPHDGVYLPKDAFFSLLGASRSAVPVMYPGAVAA AESPPSLSPSEPAEA 15.795 (326) 401 PPSASPAPLPLPSYPASYGAPVVGYDQLAARHFADYVDPHYPGWGRRYEPAPSLHPSYPVPPPPSPAYYRRRDSPGGMDEPPSGWERYDGGHRGQSQKQH AYYRRRDSPGGMDEP 18.281 (474) AYYRRRDSPGGMDEP 9.612 (474) AYYRRRDSPGGMDEP 2.941 (474) 501 RHGGSGGHNKRRKETAAASSSSSDEDLSFPGEAEHGRARKRLKSHVNSDGGSGGHAGSNQQQQQRYDELRDAIHELKRDLFAARQSSTLLSAALPSAASS RKETAAASSSSSDED 26.877 (519) RLKSHVNSDGGSGGH 17.444 (548) RKETAAASSSSSDED 19.767 (519) RARKRLKSHVNSDGG 17.119 (544) ETAAASSSSSDEDLS 15.564 (521) TAAASSSSSDEDLSF 14.766 (522) KETAAASSSSSDEDL 13.525 (520) RKETAAASSSSSDED 8.991 (519) RARKRLKSHVNSDGG 5.214 (544) AAASSSSSDEDLSFP 3.031 (523) 601 SPTTTTVCTPTGELTSGGGETPTALLSGGAKVAERAQAGVVNASCRLATASGSEAATAGPSTAGSSSCPASVVLAAAAAQAAAASQSPPKDMVDLNRRIF AAQAAAASQSPPKDM 17.412 (685) QAAAASQSPPKDMVD 3.822 (687) 701 VAALNKLE 304/2881) score = 481.427 25.878 (total and max score) >gi|52139218|ref|YP_081491.1| tegument protein pp150 [Human herpesvirus 5] 1 MSLQFIGLQRRDVVALVNFLRHLTQKPDVDLEAHPKILKKCGEKRLHRRTVLFNELMLWLGYYRELRFHNPDLSSVLEEFEVRCAAVARRGYTYPFGDRG 101 KARDHLAVLDRTEFDTDVRHDAEIVERALVSAVILAKMSVRETLVTAIGQTEPIAFVHLKDTEVQRIEENLEGVRRNMFCAKPLDLNLDRHANTALVNAV 201 NKLVYTGRLIMNVRRSWEELERKCLARIQERCKLLVKELRMCLSFDSNYCRNILKHAVENGDSADTLLELLIEDFDIYVDSFPQSAHTFLGARSPSLEFD HTFLGARSPSLEFDD 12.331 (294) FLGARSPSLEFDDDA 5.767 (296) FLGARSPSLEFDDDA 2.383 (296) 301 DDANLLSLGGGSAFSSVPKKHVPTQPLDGWSWIASPWKGHKPFRFEAHGSLAPAAEAHAARSAAVGYYDEEEKRRERQKRVDDEVVQREKQQLKAWEERQ DGWSWIASPWKGHKP 4.965 (335) RSAAVGYYDEEEKRR 14.207 (368) DGWSWIASPWKGHKP 3.228 (335) 401 QNLQQRQQQPPPPTRKPGASRRLFGSSADEDDDDDDDDEKNIFTPIKKPGTSGKGAASGGGVSSIFSGLLSSGSQKPTSGPLNIPQQQQRHAAFSLVSPQ SRRLFGSSADEDDDD 12.380 (427) SGLLSSGSQKPTSGP 14.039 (474) SPQVTKASPGRVRRD 14.715 (505) SRRLFGSSADEDDDD 8.666 (427) SPQVTKASPGRVRRD 4.623 (505) DDEKNIFTPIKKPGT 8.425 (444) SRRLFGSSADEDDDD 6.557 (427) 501 VTKASPGRVRRDSAWDVRPLTETRGDLFSGDEDSDSSDGYPPNRQDPRFTDTLVDITDTETSAKPPVTTAYKFEQPTLTFGAGVNVPAGAGAAILTPTPV LFSGDEDSDSSDGYP 25.878 (534) ETRGDLFSGDEDSDS 14.943 (529) GDEDSDSSDGYPPNR 13.800 (537) DSDSSDGYPPNRQDP 10.989 (540) ETRGDLFSGDEDSDS 6.686 (529) SGDEDSDSSDGYPPN 5.959 (536) PGRVRRDSAWDVRPL 3.022 (513) 601 NPSTAPAPAPTPTFAGTQTPVNGNSPWAPTAPLPGDMNPANWPRERAWALKNPHLAYNPFRMPTTSTASQNTVSTTPRRPSTPRAAVTQTASRDAADEVW 701 ALRDQTAESPVEDSEEEDDDSSDTGSVVSLGHTTPSSDYNNDVISPPSQTPEQSTPSRIRKAKLSSPMTTTSTSQKPVLGKRVATPHASARAQTVTSTPV EEEDDDSSDTGSVVS 20.241 (722) IRKAKLSSPMTTTST 19.132 (766) AESPVEDSEEEDDDS 20.005 (714) VISPPSQTPEQSTPS 16.754 (750) VLGKRVATPHASARA 13.384 (785) EEEDDDSSDTGSVVS 16.593 (722) SQTPEQSTPSRIRKA 8.728 (755) AESPVEDSEEEDDDS 10.177 (714) DYNNDVISPPSQTPE 12.585 (745) HTTPSSDYNNDVISP 8.328 (739) AESPVEDSEEEDDDS 6.855 (714) AESPVEDSEEEDDDS 4.392 (714) 801 QGRLEKQVSGTPSTVPATLLQPQPASSKTTSSRNVTSGAGTSSASSARQPSASASVLSPTEDDVVSPATSPLSMLSSASPSPAKSAPPSPVKGRGSRVGV LEKQVSGTPSTVPAT 13.225 (811) ASSARQPSASASVLS 13.229 (851) PAKSAPPSPVKGRGS 18.379 (889) ASPSPAKSAPPSPVK 18.155 (885) MLSSASPSPAKSAPP 13.537 (881) PTEDDVVSPATSPLS 12.456 (866) PAKSAPPSPVKGRGS 8.577 (889) MLSSASPSPAKSAPP 6.533 (881) PAKSAPPSPVKGRGS 5.635 (889) 901 PSLKPTLGGKAVVGRPPSVPVSGSAPGRLSGSSRAASTTPTYPAVTTVYPPSSTAKSSVSNAPPVASPSILKPGASAALQSRRSTGIAAVGSPVKSTTGM SSRAASTTPTYPAVT 12.542 (939) TGIAAVGSPVKSTTG 8.422 (992) 1001 KTVAFDLSSPQKSGTGPQPGSAGMGGAKTPSDAVQNILQKIEKIKNTEE 305/2881) score = 495.755 25.878 (total and max score) >gi|9625717|ref|NP_039966.1| UL32 [Human herpesvirus 5 strain AD169] 1 MSLQFIGLQRRDVVALVNFLRHLTQKPDVDLEAHPKILKKCGEKRLHRRTVLFNELMLWLGYYRELRFHNPDLSSVLEEFEVRCVAVARRGYTYPFGDRG 101 KARDHLAVLDRTEFDTDVRHDAEIVERALVSAVILAKMSVRETLVTAIGQTEPIAFVHLKDTEVQRIEENLEGVRRNMFCVKPLDLNLDRHANTALVNAV 201 NKLVYTGRLIMNVRRSWEELERKCLARIQERCKLLVKELRMCLSFDSNYCRNILKHAVENGDSADTLLELLIEDFDIYVDSFPQSAHTFLGARSPSLEFD HTFLGARSPSLEFDD 12.331 (294) FLGARSPSLEFDDDA 5.767 (296) FLGARSPSLEFDDDA 2.383 (296) 301 DDANLLSLGGGSAFSSVPKKHVPTQPLDGWSWIASPWKGHKPFRFEAHGSLAPAAEAHAARSAAVGYYDEEEKRRERQKRVDDEVVQREKQQLKAWEERQ DGWSWIASPWKGHKP 4.965 (335) RSAAVGYYDEEEKRR 14.207 (368) DGWSWIASPWKGHKP 3.228 (335) 401 QNLQQRQQQPPPPARKPSASRRLFGSSADEDDDDDDDEKNIFTPIKKPGTSGKGAASGGGVSSIFSGLLSSGSQKPTSGPLNIPQQQQRHAAFSLVSPQV PPPARKPSASRRLFG 15.614 (418) SGLLSSGSQKPTSGP 14.039 (473) SPQVTKASPGRVRRD 14.715 (504) SRRLFGSSADEDDDD 12.380 (427) SPQVTKASPGRVRRD 4.623 (504) SRRLFGSSADEDDDD 8.666 (427) DDEKNIFTPIKKPGT 8.425 (443) SRRLFGSSADEDDDD 6.557 (427) 501 TKASPGRVRRDSAWDVRPLTETRGDLFSGDEDSDSSDGYPPNRQDPRFTDTLVDITDTETSAKPPVTTAYKFEQPTLTFGAGVNVPAGAGAAILTPTPVN LFSGDEDSDSSDGYP 25.878 (533) ETRGDLFSGDEDSDS 14.943 (528) GDEDSDSSDGYPPNR 13.800 (536) DSDSSDGYPPNRQDP 10.989 (539) ETRGDLFSGDEDSDS 6.686 (528) SGDEDSDSSDGYPPN 5.959 (535) PGRVRRDSAWDVRPL 3.022 (512) 601 PSTAPAPAPTPTFAGTQTPVNGNSPWAPTAPLPGDMNPANWPRERAWALKNPHLAYNPFRMPTTSTASQNTVSTTPRRPSTPRAAVTQTASRDAADEVWA 701 LRDQTAESPVEDSEEEDDDSSDTGSVVSLGHTTPSSDYNNDVISPPSQTPEQSTPSRIRKAKLSSPMTTTSTSQKPVLGKRVATPHASARAQTVTSTPVQ EEEDDDSSDTGSVVS 20.241 (721) IRKAKLSSPMTTTST 19.132 (765) AESPVEDSEEEDDDS 20.005 (713) VISPPSQTPEQSTPS 16.754 (749) VLGKRVATPHASARA 13.384 (784) EEEDDDSSDTGSVVS 16.593 (721) SQTPEQSTPSRIRKA 8.728 (754) AESPVEDSEEEDDDS 10.177 (713) DYNNDVISPPSQTPE 12.585 (744) HTTPSSDYNNDVISP 8.328 (738) AESPVEDSEEEDDDS 6.855 (713) AESPVEDSEEEDDDS 4.392 (713) 801 GRLEKQVSGTPSTVPATLLQPQPASSKTTSSRNVTSGAGTSSASSARQPSASASVLSPTEDDVVSPATSPLSMLSSASPSPAKSAPPSPVKGRGSRVGVP LEKQVSGTPSTVPAT 13.225 (810) ASSARQPSASASVLS 13.229 (850) PAKSAPPSPVKGRGS 18.379 (888) ASPSPAKSAPPSPVK 18.155 (884) MLSSASPSPAKSAPP 13.537 (880) PTEDDVVSPATSPLS 12.456 (865) PAKSAPPSPVKGRGS 8.577 (888) MLSSASPSPAKSAPP 6.533 (880) PAKSAPPSPVKGRGS 5.635 (888) 901 SLKPTLGGKAVVGRPPSVPVSGSAPGRLSGSSRAASTTPTYPAVTTVYPPSSTAKSSVSNAPPVASPSILKPGASAALQSRRSTGTAAVGSPVKSTTGMK SSRAASTTPTYPAVT 12.542 (938) TGTAAVGSPVKSTTG 7.136 (991) 1001 TVAFDLSSPQKSGTGPQPGSAGMGGAKTPSDAVQNILQKIEKIKNTEE 340/2881) score = 89.242 25.088 (total and max score) >gi|52139187|ref|YP_081460.1| membrane protein RL12 [Human herpesvirus 5] 1 MRVDRQKRNNFTYRQTVYIILTFYIVYRGKCNSTDTNNSTSTSDSTVSDTSVYSTPNLPSTFFTTLDTSTGSQISTTSNTISSTTNTLAASSITTLNTST SDTSVYSTPNLPSTF 5.626 (55) 101 NTTSYTASTLTALSSTHTNSPILSNNATLYTTSLDNTTTDITSSESSINASTIHNTTYSPVTSIAVNCTVAANETNNSSSKNCQQDIGTIRVKSTTLTAE 201 EGKNITIQGNSTWNCPNVVWYRHYNWSTHGHHIYPNRRYQTPTYQHKILTSHPICHPDVSSPAAYHDLCRSCNKTELRIYDLNTTNSGRYSRRCYKEYNH 301 DGPHEDENFGLTVNPRNDTDNHTTPLCPRYVGTQSEEDEDDDYTLSTITNNNMRKTSHRDISHGTRTTWALTLICIACILLFFVRRALNKRYRPLRDDIS EEDEDDDYTLSTITN 25.088 (343) RPLRDDISESSFVVR 16.918 (400) PRYVGTQSEEDEDDD 20.366 (335) PRYVGTQSEEDEDDD 14.444 (335) EEDEDDDYTLSTITN 6.800 (343) 401 ESSFVVRYHPEHED 367/2881) score = 136.289 24.625 (total and max score) >gi|52139246|ref|YP_081520.1| deoxyuridine triphosphatase [Human herpesvirus 5] 1 MLTMLTDRIDSQLVLSRLPRSRFQRFWETPTLIMKEESAPSSGSIILAEKSVNMRYCVRFASDSDFQTTFTLPQSTEEKYDKEQHPGEDEASSPLPSPLK PGEDEASSPLPSPLK 13.062 (93) PQSTEEKYDKEQHPG 9.338 (80) EASSPLPSPLKVPYK 7.474 (97) PGEDEASSPLPSPLK 6.143 (93) 101 VPYKWMPSSFIVKQCHTQLAFYNKHIIWLSRERKVPTSLGVSLYIPEGFFGITFYKCLDAQFVCMPELLESGLQVPQLDVVNLNDTFQSIFPGTIEGDIG 201 VFPCFVPEPWQLMNLPPPNEHRFFSLRTRQTLVIGPGHTQTVYFDAAYVHAPGICALIVGVRQFSQSDLIIRPTIWLPGTAAGVTVVNTSHTTVCISPHT 301 TVAKAVFTTHRFTYLPVGSHPLGQMIVPPTPDIGFTHTPEHALLQRTPSPVDDDVDETEEDEKSSDAESPVNTSDVIFDVGPKPPRHP EKSSDAESPVNTSDV 24.625 (369) ALLQRTPSPVDDDVD 19.420 (349) TEEDEKSSDAESPVN 19.351 (365) TEEDEKSSDAESPVN 17.897 (365) VDDDVDETEEDEKSS 14.938 (358) ALLQRTPSPVDDDVD 4.041 (349) 372/2881) score = 157.319 24.529 (total and max score) >gi|9625781|ref|NP_040030.1| UL95 [Human herpesvirus 5 strain AD169] 1 MMAAAVVRAEVRRQRREERKKMAAARTTEDPPENHVVADVARGTGAVTRSSSSSLVVSSSSASGSDESSSASPLSFPVSSPSTAVRSPGSAGVSTSLCSV SLVVSSSSASGSDES 24.529 (61) VVSSSSASGSDESSS 19.720 (63) SSSSASGSDESSSAS 13.693 (65) SSSSASGSDESSSAS 13.554 (65) SGSDESSSASPLSFP 12.774 (70) VVSSSSASGSDESSS 12.239 (63) GAVTRSSSSSLVVSS 7.162 (52) 101 ERMVELSAQSPAADFSVSEAWRFEEAVNMALVACEAVSPYDRFRLIETPDENFLLVTNVIPRESAEVPVLDSSSSGGDSGPEDKKKNVGNKTAGEKNGGG PVLDSSSSGGDSGPE 16.295 (175) SSSSGGDSGPEDKKK 14.874 (179) 201 SRAKRRRRRRAPKNDAATPSFLRRHDVLERFAAAAKPLPSLCVRDYALRNADRVTYDGELIYGSYLLYRKAHVELSLSSNKVQHVEAVLRQVYTPGLLDH APKNDAATPSFLRRH 14.828 (218) 301 HNVCDVEALLWLLYCGPRSFCARDTCFGREKNGCPFPALLPKLFYEPVRDYMTYMNLAELYVFVWYRGYEFPAPTPQATTAGGGGGSGGGGGAGACAVET VFVWYRGYEFPAPTP 7.650 (369) 401 SASAGRVDDAGDEVHLPLKPVSLDRLREVLQAVRGRFSGREVPAWPASSRTCLLCALYSQNRLCLDLARDEARTVSYSPIVIQDCAAAVTDVTLSHILPG 501 QSTVSLFPVYHVGKLLDALSLNDAGLITLNL 373/2881) score = 157.319 24.529 (total and max score) >gi|52139267|ref|YP_081542.1| protein UL95 [Human herpesvirus 5] 1 MMAAAVVRAEVRRQRREERKKMASARTTEDPPENHVVADVACGTGAVTRSSSSSLVVSSSSASGSDESSSASPLSFPVSSPSTAVRSPGSAGVSTSLCSV SLVVSSSSASGSDES 24.529 (61) VVSSSSASGSDESSS 19.720 (63) SSSSASGSDESSSAS 13.693 (65) SSSSASGSDESSSAS 13.554 (65) SGSDESSSASPLSFP 12.774 (70) VVSSSSASGSDESSS 12.239 (63) GAVTRSSSSSLVVSS 7.162 (52) 101 ERMVELSAQSPAADFSVSEAWRFEEAVNMALVACEAVSPYDRFRLIETPDENFLLVTNVIPRESAEVPVLDSSSSGGDSGPEDKKKNVGNKTAGEKNGGG PVLDSSSSGGDSGPE 16.295 (175) SSSSGGDSGPEDKKK 14.874 (179) 201 SRAKRRRRRRAPKNDAATPSFLRRHDVLERFAAAAEPLPSLCVHDYALRNADRVTYDGELIYGSYLLYRKAHVELSLSSNKVQHVEAVLRQVYTPGLLDH APKNDAATPSFLRRH 14.828 (218) 301 HNVCDVEALLWLLYCGPRSFCARDTCFGREKNGCPFPALLPKLFYEPVRDYMTYMNLAELYVFVWYRGYEFPAPTPQATTAGGGGGGGSGGGGGAGACAV VFVWYRGYEFPAPTP 7.650 (369) 401 ETSASAGRVDDAGDEVHLPLKPVSLDRLREVLQAVRGRFSGREVPAWPASSRTCLLCALYSQNRLCLDLARDEARTVSYSPIVIQDCAAAVTDVTLSHIL 501 PGQSTVSLFPVYHVGKLLDALSLNDAGLITLNL 382/2881) score = 74.126 24.335 (total and max score) >gi|9625770|ref|NP_040019.1| UL84 [Human herpesvirus 5 strain AD169] 1 MPRVDPNLRNRARRPRARRGGGGGVGSNSSRHSGKCRRQRRALSAPPLTFLATTTTTTMMGVASTDDDSLLLKTPDELDKYSGSPQTILTLTDKHDIRQP RRQRRALSAPPLTFL 14.892 (44) TMMGVASTDDDSLLL 12.885 (65) 101 RVHRGTYHLIQLHLDLRPEELRDPFQILLSTPLQLGEANDESQTAPATLQEEETAASHEPEKKKEKQEKKEEDEDDRNDDRERGILCVVSNEDSDVRPAF RGILCVVSNEDSDVR 13.861 (190) 201 SLFPARPGCHILRSVIDQQLTRMAIVRLSLNLFALRIITPLLKRLPLRRKAAHHTALHDCLALHLPELTFEPTLDINNVTENAASVADTAESTDADLTPT 301 LTVRVRHALCWHRVEGGISGPRGLTSRISARLSETTAKTLGPSVFGRLELDPNESPPDLTLSSLTLYQDGILRFNVTCDRTEAPADPVAFRLRLRRETVR 401 RPFFSDAPLPYFVPPRSGAADEGLEVRVPYELTLKNSHTLRIYRRFYGPYLGVFVPHNRQGLKMPVTVWLPRSWLELTVLVSDENGATFPRDALLGRLYF 501 ISSKHTLNRGCLSAMTHQVKSTLHSRSTSHSPSQQQLSVLGASIALEDLLPMRLASPETEPQDCKLTENTTEKTSPVTLAMVCGDL KSTLHSRSTSHSPSQ 24.335 (527) TLHSRSTSHSPSQQQ 8.153 (529) 383/2881) score = 93.971 24.335 (total and max score) >gi|52139257|ref|YP_081532.1| protein UL84 [Human herpesvirus 5] 1 MPRVDPNLRNRARRPRARRGGGGGVGSNSSRHSGKCRRQRRALSTPPLTFLATTTTTTMMGVASTDDDSLLLKTPDELDKHSGSPQTILTLTDKHDIRQP RRQRRALSTPPLTFL 16.977 (44) TMMGVASTDDDSLLL 12.885 (65) 101 RVHRGTYHLIQLHLDLRPEELRDPFQILLSTPLQLGEANGESQTAPATSQEEETAASHEPEKKKEKEEKKEEEDEDDRNDDRERGILCVVSNEDSDVRPA SQTAPATSQEEETAA 13.598 (149) RGILCVVSNEDSDVR 13.861 (191) SQTAPATSQEEETAA 4.161 (149) 201 FSLFPARPGCHILRSVIDQQLTRMAIVRLSLNLFALRIITPLLKRLPLRRKAAHHTALHDCLALHLPELTFEPTLDINNVTENAASVADTAESTDADLTP 301 TLTVRVRHALCWHRVEGGISGPRGLTSRISARLSETTAKTLGPSVFGRLELDPNESPPDLTLSSLTLYQDGILRFNVTCDRTEAPADPVAFRLRLRRETV 401 RRPFFSDAPLPYFVPPRSGAADEGLEVRVPYELTLKNSHTLRIYRRFYGPYLGVFVPHNRQGLKMPVTVWLPRSWLELTVLVSDENGATFPRDALLGRLY 501 FISSKHTLNRGCLSAMTHQVKSTLHSRSTSHSPSQQQLSVLGASIALEDLLPMRLASPETEPQDCKLTENTTEKTSPVTLAMVCGDL KSTLHSRSTSHSPSQ 24.335 (528) TLHSRSTSHSPSQQQ 8.153 (530) 385/2881) score = 58.709 24.283 (total and max score) >gi|52139247|ref|YP_081522.1| envelope glycoprotein O [Human herpesvirus 5] 1 MGKKEMIMVKGIPKIMLLISITFLLLSLINCNVLVNSRGTRRSWPYTVLSYRGKEILKKQKEDILKRLMSTSSDGYRFLMYPSQQKFHAIVISMDKFPQD DILKRLMSTSSDGYR 24.283 (70) NSRGTRRSWPYTVLS 13.349 (43) KRLMSTSSDGYRFLM 2.537 (73) 101 YILAGPIRNDSITHMWFDFYSTQLRKPAKYVYSEYNHTAHKITLRPPPCGTVPSMNCLSEMLNVSKRNDTGEKGCGNFTTFNPMFFNVPRWNTKLYIGSN 201 KVNVDSQTIYFLGLTALLLRYAQRNCTRSFYLVNAMSRNLFRVPKYINGTKLKNTMRKLKRKQALVKEQPQKKNKKSQSTTTPYLSYTTSTAFNVTTNVT 301 YSATAAVTRVATSTTGYRPDSNFMKSIMATQLRDLATWVYTTLRYRNEPFCKPDRNRTAVSEFMKNTHVLIRNETPYTIYGTLDMSSLYYNETMSVENET 401 ASDNNETTPTSPSTRFQRTFIDPLWDYLDSLLFLDKIRNFSLQLPAYGNLTPPEHRRAANLSTLNSLWWWSQ ASDNNETTPTSPSTR 18.539 (408) 391/2881) score = 95.155 24.142 (total and max score) >gi|28373227|ref|NP_783803.1| US1 [Human herpesvirus 5 strain AD169] 1 MASGLGDLSVGVSSLPMRELAWRRVADDSHDLWCCCMDWKAHVEYAHPASELRPGSGGWPEHAEAQWRQQVHAAHDVWCNCGDWQGHALRSRSRTAESGR RTAESGRSSSSSSVS 14.835 (101) RTAESGRSSSSSSVS 13.711 (101) ESGRSSSSSSVSVLS 12.292 (104) GRSSSSSSVSVLSDG 10.866 (106) AESGRSSSSSSVSVL 6.816 (103) ALRSRSRTAESGRSS 6.592 (95) TAESGRSSSSSSVSV 5.901 (102) 101 SSSSSSVSVLSDGDQQPWWRRLRVKRPKFPSWARRWTQRHDSEERASQQAENDSTS HDSEERASQQAENDS 24.142 (147) 396/2881) score = 170.939 24.042 (total and max score) >gi|52139256|ref|YP_081531.1| tegument protein pp65 [Human herpesvirus 5] 1 MESRGRRCPEMISVLGPISGHVLKAVFSRGDTPVLPHETRLLQTGIHVRVSQPSLILVSQYTPDSTPCHRGDNQLQVQHTYFTGSEVENVSVNVHNPTGR 101 SICPSQEPMSIYVYALPLKMLNIPSINVHHYPSAAERKHRHLPVADAVIHASGKQMWQARLTVSGLAWTRQQNQWKEPDVYYTSAFVFPTKDVALRHVVC 201 AHELVCSMENTRATKMQVIGDQYVKVYLESFCEDVPSGKLFMHVTLGSDVEEDLTMTRNPQPFMRPHERNGFTVLCPKNMIIKPGKISHIMLDVAFTSHE FMHVTLGSDVEEDLT 2.459 (248) 301 HFGLLCPKSIPGLSISGNLLMNGQQIFLEVQAIRETVELRQYDPVAALFFFDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVW GDDDVWTSGSDSDEE 22.405 (402) GDDDVWTSGSDSDEE 20.435 (402) DDVWTSGSDSDEELV 19.682 (404) VWTSGSDSDEELVTT 15.216 (406) DDVWTSGSDSDEELV 12.801 (404) DDVWTSGSDSDEELV 10.390 (404) VWTSGSDSDEELVTT 3.507 (406) 401 TSGSDSDEELVTTERKTPRVTGGGAMASASTSAGRKRKSASSATACTAGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPAVFTWPPWQAGILARNLVPMV SAGRKRKSASSATAC 3.966 (439) TVAPEEDTDEDSDNE 24.042 (468) EEDTDEDSDNEIHNP 20.035 (472) EEDTDEDSDNEIHNP 16.000 (472) 501 ATVQGQNLKYQEFFWDANDIYRIFAELEGVWQPAAQPKRRRHRQDALPGPCIASTPKKHRG 397/2881) score = 170.939 24.042 (total and max score) >gi|9625769|ref|NP_040018.1| UL83 [Human herpesvirus 5 strain AD169] 1 MESRGRRCPEMISVLGPISGHVLKAVFSRGDTPVLPHETRLLQTGIHVRVSQPSLILVSQYTPDSTPCHRGDNQLQVQHTYFTGSEVENVSVNVHNPTGR 101 SICPSQEPMSIYVYALPLKMLNIPSINVHHYPSAAERKHRHLPVADAVIHASGKQMWQARLTVSGLAWTRQQNQWKEPDVYYTSAFVFPTKDVALRHVVC 201 AHELVCSMENTRATKMQVIGDQYVKVYLESFCEDVPSGKLFMHVTLGSDVEEDLTMTRNPQPFMRPHERNGFTVLCPKNMIIKPGKISHIMLDVAFTSHE FMHVTLGSDVEEDLT 2.459 (248) 301 HFGLLCPKSIPGLSISGNLLMNGQQIFLEVQAIRETVELRQYDPVAALFFFDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVW GDDDVWTSGSDSDEE 22.405 (402) GDDDVWTSGSDSDEE 20.435 (402) DDVWTSGSDSDEELV 19.682 (404) VWTSGSDSDEELVTT 15.216 (406) DDVWTSGSDSDEELV 12.801 (404) DDVWTSGSDSDEELV 10.390 (404) VWTSGSDSDEELVTT 3.507 (406) 401 TSGSDSDEELVTTERKTPRVTGGGAMAGASTSAGRKRKSASSATACTSGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPAVFTWPPWQAGILARNLVPMV SAGRKRKSASSATAC 3.966 (439) TVAPEEDTDEDSDNE 24.042 (468) EEDTDEDSDNEIHNP 20.035 (472) EEDTDEDSDNEIHNP 16.000 (472) 501 ATVQGQNLKYQEFFWDANDIYRIFAELEGVWQPAAQPKRRRHRQDALPGPCIASTPKKHRG 411/2881) score = 206.450 23.646 (total and max score) >gi|52139271|ref|YP_081546.1| myristylated tegument protein [Human herpesvirus 5] 1 MGAELCKRICCEFGTTSGEPLKDALGRQVSLRSYDNIPPTSSSDEGEDDDDGEDDDNEERQQKLRLCGSGCGGNDSSSGSHREATHDGPKKNAVRSTFRE YDNIPPTSSSDEGED 20.927 (41) SGCGGNDSSSGSHRE 23.646 (76) DALGRQVSLRSYDNI 20.782 (30) CGGNDSSSGSHREAT 15.498 (78) NIPPTSSSDEGEDDD 17.772 (43) NIPPTSSSDEGEDDD 14.551 (43) DNIPPTSSSDEGEDD 11.391 (42) 101 DKAPKPSKQSKKKKKPSKHHHHQQSSIMQETDDLDEEDTSIYLSPPPVPPVQVVAKRLPRPDTPRTPRQKKISQRPPTPGTKKPAASLPF PRPDTPRTPRQKKIS 19.363 (166) EDTSIYLSPPPVPPV 15.376 (144) KISQRPPTPGTKKPA 15.834 (178) DEEDTSIYLSPPPVP 9.422 (142) TPRQKKISQRPPTPG 15.404 (173) PRPDTPRTPRQKKIS 3.862 (166) KRLPRPDTPRTPRQK 2.620 (163) 412/2881) score = 206.450 23.646 (total and max score) >gi|9625785|ref|NP_040034.1| UL99 [Human herpesvirus 5 strain AD169] 1 MGAELCKRICCEFGTTPGEPLKDALGRQVSLRSYDNIPPTSSSDEGEDDDDGEDDDNEERQQKLRLCGSGCGGNDSSSGSHREATHDGSKKNAVRSTFRE YDNIPPTSSSDEGED 20.927 (41) SGCGGNDSSSGSHRE 23.646 (76) DALGRQVSLRSYDNI 20.782 (30) CGGNDSSSGSHREAT 15.498 (78) NIPPTSSSDEGEDDD 17.772 (43) NIPPTSSSDEGEDDD 14.551 (43) DNIPPTSSSDEGEDD 11.391 (42) 101 DKAPKPSKQSKKKKKPSKHHHHQQSSIMQETDDLDEEDTSIYLSPPPVPPVQVVAKRLPRPDTPRTPRQKKISQRPPTPGTKKPAASLPF PRPDTPRTPRQKKIS 19.363 (166) EDTSIYLSPPPVPPV 15.376 (144) KISQRPPTPGTKKPA 15.834 (178) DEEDTSIYLSPPPVP 9.422 (142) TPRQKKISQRPPTPG 15.404 (173) PRPDTPRTPRQKKIS 3.862 (166) KRLPRPDTPRTPRQK 2.620 (163) 416/2881) score = 141.945 23.579 (total and max score) >gi|9625739|ref|NP_039988.1| UL54 [Human herpesvirus 5 strain AD169] 1 MFFNPYLSGGVTGGAVAGGRRQRSQPGSAQGSGKRPPQKQFLQIVPRGVMFDGQTGLIKHKTGRLPLMFYREIKHLLSHDMVWPCPWRETLVGRVVGPIR RQRSQPGSAQGSGKR 23.579 (28) AGGRRQRSQPGSAQG 16.444 (24) 101 FHTYDQTDAVLFFDSPENVSPRYRQHLVPSGNVLRFFGATEHGYSICVNVFGQRSYFYCEYSDTDRLREVIASVGELVPEPRTPYAVSVTPATKTSIYGY RSYFYCEYSDTDRLR 11.668 (161) ELVPEPRTPYAVSVT 3.497 (183) 201 GTRPVPDLQCVSISNWTMARKIGEYLLEQGFPVYEVRVDPLTRLVIDRRITTFGWCSVNRYDWRQQGRASTCDIEVDCDVSDLVAVPDDSSWPRYRCLSF WPRYRCLSFDIECMS 4.880 (299) 301 DIECMSGEGGFPCAEKSDDIVIQISCVCYETGGNTAVDQGIPNGNDGRGCTSEGVIFGHSGLHLFTIGTCGQVGPDVDVYEFPSEYELLLGFMLFFQRYA VGPDVDVYEFPSEYE 20.421 (380) 401 PAFVTGYNINSFDLKYILTRLEYLYKVDSQRFCKLPTAQGGRFFLHSPAVGFKRQYAAAFPSASHNNPASTAATKVYIAGSVVIDMYPVCMAKTNSPNYK 501 LNTMAELYLRQRKDDLSYKDIPRCFVANAEGRAQVGRYCLQDAVLVRDLFNTINFHYEAGAIARLAKIPLRRVIFDGQQIRIYTSLLDECACRDFILPNH 601 YSKGTTVPETNSVAVSPNAAIISTAAVPGDAGSVAAMFQMSPPLQSAPSSQDGVSPGSGSNSSSSVGVFSVGSGSSGGVGVSNDNHGAGGTAAVSYQGAT QDGVSPGSGSNSSSS 13.559 (658) 701 VFEPEVGYYNDPVAVFDFASLYPSIIMAHNLCYSTLLVPGGEYPVDPADVYSVTLENGVTHRFVRASVRVSVLSELLNKWVSQRRAVRECMRECQDPVRR VFEPEVGYYNDPVAV 10.473 (708) 801 MLLDKEQMALKVTCNAFYGFTGVVNGMMPCLPIAASITRIGRDMLERTARFIKDNFSEPCFLHNFFNQEDYVVGTREGDSEESSALPEGLETSSGGSNER LPEGLETSSGGSNER 12.204 (893) 901 RVEARVIYGDTDSVFVRFRGLTPQALVARGPSLAHYVTACLFVEPVKLEFEKVFVSLMMICKKRYIGKVEGASGLSMKGVDLVRKTACEFVKGVTRDVLS 1001 LLFEDREVSEAAVRLSRLSLDEVKKYGVPRGFWRILRRLVQARDDLYLHRVRVEDLVLSSVLSKDISLYRQSNLPHIAVIKRLAARSEELPSVGDRVFYV 1101 LTAPGVRTAPQGSSDNGDSVTAGVVSRSDAIDGTDDDADGGGVEESNRRGGEPAKKRARKPPSAVCNYEVAEDPSYVREHGVPIHADKYFEQVLKAVTNV RSDAIDGTDDDADGG 16.255 (1134) EVAEDPSYVREHGVP 8.965 (1176) 1201 LSPVFPGGETARKDKFLHMVLPRRLHLEPAFLPYSVKAHECC 417/2881) score = 129.740 23.579 (total and max score) >gi|52139240|ref|YP_081513.1| DNA polymerase catalytic subunit [Human herpesvirus 5] 1 MFFNPYLSGGVTGGAVAGGRRQRSQPGSAQGSGKRPPQKQFLQIVPRGVMFDGQTGLIKHKTGRLPLMFYREIKHLLSHDMVWPCPWRETLVGRVVGPIR RQRSQPGSAQGSGKR 23.579 (28) AGGRRQRSQPGSAQG 16.444 (24) 101 FHTYDQTDAVLFFDSPENVSPRYRQHLVPSGNVLRFFGATEHGYSICVNVFGQRSYFYCEYSDTDRLREVIASVGELVPEPRTPYAVSVTPATKTSIYGY RSYFYCEYSDTDRLR 11.668 (161) ELVPEPRTPYAVSVT 3.497 (183) 201 GTRPVPDLQCVSISNWTMARKIGEYLLEQGFPVYEVRVDPLTRLVIDRRITTFGWCSVNRYDWRQQGRASTCDIEVDCDVSDLVAVPDDSSWPRYRCLSF WPRYRCLSFDIECMS 4.880 (299) 301 DIECMSGEGGFPCAEKSDDIVIQISCVCYETGGNTAVDQGIPNGNDGRGCTSEGVIFGHSGLHLFTIGTCGQVGPDVDVYEFPSEYELLLGFMLFFQRYA VGPDVDVYEFPSEYE 20.421 (380) 401 PAFVTGYNINSFDLKYILTRLEYLYKVDSQRFCKLPTAQGGRFFLHSPAVGFKRQYAAAFPSASHNNPASTAATKVYIAGSVVIDMYPVCMAKTNSPNYK 501 LNTMAELYLRQRKDDLSYKDIPRCFVANAEGRAQVGRYCLQDAVLVRDLFNTINFHYEAGAIARLAKIPLRRVIFDGQQIRIYTSLLDECACRDFILPNH 601 YSKGTTVPETNSVAVSPNAAIISTAAVPGDAGSVAAMFQMSPPLQSAPSSQDGVSPGSGSNSSSSVGVFSVGSGSSGGVGVSNDNHGAGGTAAVSYQGAT QDGVSPGSGSNSSSS 13.559 (658) 701 VFEPEVGYYNDPVAVFDFASLYPSIIMAHNLCYSTLLVPGGEYPVDPADVYSVTLENGVTHRFVRASVRVSVLSELLNKWVSQRRAVRECMRECQDPVRR VFEPEVGYYNDPVAV 10.473 (708) 801 MLLDKEQMALKVTCNAFYGFTGVVNGMMPCLPIAASITRIGRDMLERTARFIKDNFSEPCFLHNFFNQEDYVVGTREGDSEESSTLPEGLETSSGGLNER 901 RVEARVIYGDTDSVFVRFRGLTPQALVARGPSLAHYVTACLFVEPVKLEFEKVFVSLMMICKKRYIGKVEGASGLSMKGVDLVRKTACEFVKGVTRDVLS 1001 LLFEDREVSEAAVRLSRLSLDEVKKYGVPRGFWRILRRLVQARDDLYLHRVRVEDLVLSSVLSKDISLYRQSNLPHIAVIKRLAARSEELPSVGDRVFYV 1101 LTAPGVRAAPQGSSDNGDSVTTGVVSRSDAIDGTDDDADGGGVEESNRRGGEPAKKRARKPPSAVCNYEVAEDPSYVREHGVPIHADKYFEQVLKAVTNV RSDAIDGTDDDADGG 16.255 (1134) EVAEDPSYVREHGVP 8.965 (1176) 1201 LSPVFPGGETARKDKFLHMVLPRRLHLEPAFLPYSVKAHECC 443/2881) score = 45.055 23.146 (total and max score) >gi|52139338|ref|YP_081613.1| protein US29 [Human herpesvirus 5] 1 MRCFRWWLYSGWWWLTFGCARTVTVGFVAPTVRAQSTVVRSEPAPPSETRRDNNDTSYFSSTSFHSSVSPATSVDRQFRRTTYDRWDGRRWLRTRYGNAS RDNNDTSYFSSTSFH 11.036 (58) RQFRRTTYDRWDGRR 10.873 (83) 101 ACVTGTQWSTNFFFSQCEHYPSFVKLNGVQRWTPVRRPMGEVAYYGGCCMVGGGNRAYVILVSGYGTASYGNALRVDFGRGNCTAPKRTYPRRLELHDGR 201 TDPSRCDPYQVYFYGLQCPEQLVITAHGGVGMRRCPTGSRPTPSRPHRHDLENELHGLCVDLLVCVLLLALLLLELVPMEAVRHPLLFWRRVALSPSTSK FWRRVALSPSTSKVD 23.146 (295) 301 VDRAVKLCLRRMLGLPPPPSVAPPGEKKELPAQAALSPPLTTWSLPPFPSTRIPDSPPPPYQLRHATSLVTVPTLLLYTSSDIGDTASETTCVAHATYGE 401 PPEPARSTATVQECTVLTAPNCGIVNNDGAVSEGQDHGDAVHHSLDVVSQCAADTGVVDTSE 444/2881) score = 45.055 23.146 (total and max score) >gi|9625865|ref|NP_040114.1| US29 [Human herpesvirus 5 strain AD169] 1 MRCFRWWLYSGWWWLTFGCARTVTVGFVAPTVRAQSTVVRSEPAPPSETRRDNNDTSYFSSTSFHSSVSPATSVDRQFRRTTYDRWDGRRWLRTRYGNAS RDNNDTSYFSSTSFH 11.036 (58) RQFRRTTYDRWDGRR 10.873 (83) 101 ACVTGTQWSTNFFFSQCEHYPSFVKLNGVQRWTPVRRPMGEVAYYGGCCMVGGGNRAYVILVSGYGTASYGNALRVNFGRGNCTAPKRTYPRRLELHDGR 201 TDPSRCDPYQVYFYGLQCPEQLVITAHGGVGMRRCPTGSRPTPSRPHRHDLENELHGLCVDLLVCVLLLALLLLELVPMEAVRHPLLFWRRVALSPSTSK FWRRVALSPSTSKVD 23.146 (295) 301 VDRAVKLCLRRMFGLPPPPSVAPPGEKKELPAQAALSPPLTTWSLPPFPSTRIPDSPPPPYQLRHATSLVTVPTLLLYTSSDIGDTASETTCVAHATYGE 401 PPEPARSTATVQECTVLTAPNCGIVNNDGAVSEGQDHGDAVHHSLDVVSQCAADTGVVDTSE 449/2881) score = 276.773 23.004 (total and max score) >gi|52139287|ref|YP_081562.1| regulatory protein IE1 [Human herpesvirus 5] 1 MESSAKRKMDPDNPDEGPSSKVPRPETPVTKATTFLQTMLRKEVNSQLSLGDPLFPELAEESLKTFEQVTEDCNENPEKDVLTELVKQIKVRVDMVRHRI SKVPRPETPVTKATT 13.293 (27) SKVPRPETPVTKATT 5.138 (27) 101 KEHMLKKYTQTEEKFTGAFNMMGGCLQNALDILDKVHEPFEDMKCIGLTMQSMYENYIVPEDKREMWMACIKELHDVSKGAANKLGGALQAKARAKKDEL 201 RRKMMYMCYRNIEFFTKNSAFPKTTNGCSQAMAALQNLPQCSPDEIMSYAQKIFKILDEERDKVLTHIDHIFMDILTTCVETMCNEYKVTSDACMMTMYG 301 GISLLSEFCRVLCCYVLEETSVMLAKRPLITKPEVISVMKRRIEEICMKVFAQYILGADPLRVCSPSVDDLRAIAEESDEEEAIVAYTLATAGASSSDSL SSSDSLVSPPESPVP 23.004 (402) LRAIAEESDEEEAIV 18.740 (378) SLVSPPESPVPATIP 16.853 (406) LRAIAEESDEEEAIV 12.493 (378) LRAIAEESDEEEAIV 7.254 (378) AGASSSDSLVSPPES 5.659 (399) SLVSPPESPVPATIP 4.803 (406) 401 VSPPESPVPATIPLSSVIVAENSDQEESEQSDEEQEEGAQEEREDTVSVKSEPVSEIEEVASEEEEDGAEEPTASGGKSTHPMVTRSKADQ DQEESEQSDEEQEEG 22.363 (431) SEIEEVASEEEEDGA 15.571 (462) DQEESEQSDEEQEEG 22.019 (431) SEIEEVASEEEEDGA 13.224 (462) DQEESEQSDEEQEEG 21.948 (431) SEIEEVASEEEEDGA 11.996 (462) ENSDQEESEQSDEEQ 16.913 (428) SEIEEVASEEEEDGA 6.419 (462) EDTVSVKSEPVSEIE 16.232 (451) SVIVAENSDQEESEQ 11.112 (423) SVKSEPVSEIEEVAS 3.503 (455) DQEESEQSDEEQEEG 8.238 (431) 499/2881) score = 60.696 22.422 (total and max score) >gi|52139262|ref|YP_081537.1| DNA packaging terminase subunit 1 [Human herpesvirus 5] 1 MLRGDSAAKIQERYAELQKRKSHPTSCISTAFTNVAALCRKRYQMMHPELGLAHSCNEAFLPLMAFCGRHRDYNSPEESQRELLFHERLKSALDELTFRP GRHRDYNSPEESQRE 22.422 (75) GRHRDYNSPEESQRE 21.561 (75) GRHRDYNSPEESQRE 7.317 (75) 101 CSEEQRASYQKLDALTELYRDPQFQQINNFMTDFKKWLDGGFSTAVEGDAKAIRLEPFQKNLLIHVIFFIAVTKIPVLANRVLQYLIHAFQIDFLSQTSI 201 DIFKQKATVFLVPRRHGKTWFIIPIISFLLKHMIGISIGYVAHQKHVSQFVLKEVEFRCRHTFARDYVVENKDNVISIDHRGAKSTALFASCYNTNSIRG RHTFARDYVVENKDN 7.000 (267) 301 QNFHLLLVDEAHFIKKEAFNTILGFLAQNTTKIIFISSTNTTSDATCFLTRLNNAPFDMLNVVSYVCEEHLHSFTEKGDATACPCYRLHKPTFISLNSQV 401 RKTANMFMPGAFMDEIIGGTNKISQNTVLITDQSREEFDILRYSTLNTNAYDYFGKTLYVYLDPAFTTNRKASGTGVAAVGAYRHQFLIYGLEHFFLRDL 501 SESSEVAIAECAAHMIISVLSLHPYLDELRIAVEGNTNQAAAVRIACLIRQSVQSSTLIRVLFYHTPDQNHIEQPFYLMGRDKALAVEQFISRFNSGYIK NSGYIKASQELVSYT 2.396 (602) 601 ASQELVSYTIKLSHDPIEYLLEQIQNLHRVTLAEGTTARYSAKRQNRISDDLIIAVIMATYLCDDIHAIRFRVS 500/2881) score = 60.696 22.422 (total and max score) >gi|9625775|ref|NP_040024.1| UL89 [Human herpesvirus 5 strain AD169] 1 MLRGDSAAKIQERYAELQKRKSHPTSCISTAFTNVATLCRKRYQMMHPELGLAHSCNEAFLPLMAFCGRHRDYNSPEESQRELLFHERLKSALDKLTFRP GRHRDYNSPEESQRE 22.422 (75) GRHRDYNSPEESQRE 21.561 (75) GRHRDYNSPEESQRE 7.317 (75) 101 CSEEQRASYQKLDALTELYRDPQFQQINNFMTDFKKWLDGGFSTAVEGDAKAIRLEPFQKNLLIHVIFFIAVTKIPVLANRVLQYLIHAFQIDFLSQTSI 201 DIFKQKATVFLVPRRHGKTWFIIPIISFLLKHMIGISIGYVAHQKHVSQFVLKEVEFRCRHTFARDYVVENKDNVISIDHRGAKSTALFASCYNTNSIRG RHTFARDYVVENKDN 7.000 (267) 301 QNFHLLLVDEAHFIKKEAFNTILGFLAQNTTKIIFISSTNTTSDSTCFLTRLNNAPFDMLNVVSYVCEEHLHSFTEKGDATACPCYRLHKPTFISLNSQV 401 RKTANMFMPGAFMDEIIGGTNKISQNTVLITDQSREEFDILRYSTLNTNAYDYFGKTLYVYLDPAFTTNRKASGTGVAAVGAYRHQFLIYGLEHFFLRDL 501 SESSEVAIAECAAHMIISVLSLHPYLDELRIAVEGNTNQAAAVRIACLIRQSVQSSTLIRVLFYHTPDQNHIEQPFYLMGRDKALAVEQFISRFNSGYIK NSGYIKASQELVSYT 2.396 (602) 601 ASQELVSYTIKLSHDPIEYLLEQIQNLHRVTLAEGTTARYSAKRQNRISDDLIIAVIMATYLCDDIHAIRFRVS 520/2881) score = 153.544 22.091 (total and max score) >gi|28373231|ref|NP_783808.1| US28 [Human herpesvirus 5 strain AD169] 1 MTPTTTTAELTTEFDYDEDATPCVFTDVLNQSKPVTLFLYGVVFLFGSIGNFLVIFTITWRRRIQCSGDVYFINLAAADLLFVCTLPLWMQYLLDHNSLA 101 SVPCTLLTACFYVAMFASLCFITEIALDRYYAIVYMRYRPVKQACLFSIFWWIFAVIIAIPHFMVVTKKDNQCMTDYDYLEVSYPIILNVELMLGAFVIP EIALDRYYAIVYMRY 9.789 (131) KKDNQCMTDYDYLEV 12.728 (175) 201 LSVISYCYYRISRIVAVSQSRHKGRIVRVLIAVVLVFIIFWLPYHLTLFVDTLKLLKWISSSCEFERSLKRALILTESLAFCHCCLNPLLYVFVGTKFRQ 301 ELHCLLAEFRQRLFSRDVSWYHSMSFSRRSSPSRRETSSDTLSDEVCRVSQIIP SSPSRRETSSDTLSD 22.091 (337) WYHSMSFSRRSSPSR 21.714 (327) FSRRSSPSRRETSSD 16.574 (333) PSRRETSSDTLSDEV 15.618 (339) MSFSRRSSPSRRETS 14.578 (331) SMSFSRRSSPSRRET 12.978 (330) MSFSRRSSPSRRETS 9.420 (331) MSFSRRSSPSRRETS 6.669 (331) MSFSRRSSPSRRETS 4.620 (331) EFRQRLFSRDVSWYH 4.266 (315) MSFSRRSSPSRRETS 2.500 (331) 541/2881) score = 27.457 21.818 (total and max score) >gi|52139206|ref|YP_081479.1| membrane protein UL20 [Human herpesvirus 5] 1 MLGIRAMLVMLDYYWIQLITNNGTRSNNTDTIFVSLLTGPNGVTRTAIGGLYSNYTNLTGAFGFTSTNMSATNSSAEDNWSVTNLTESCINRGESYVTTI 101 WLLDCTKNDTYWYYGNAYNHTCEGTISGYLLGMCKLWKSWVNNITSYNTVRVESLGNETRCMLLPRQYTLNATVEWYNKSEGDVPEEFMDYVILTPLAVL TVEWYNKSEGDVPEE 5.639 (180) 201 TCGLQEAYILDKGRRYMYLFSVSCVGITGTVSIILVSLSLLILICYYRCGRLLICPRGFELLPEFTEEEEEKEKLLTHNDIEVQVPIRTRRLLVPWIRES 301 KMWVLPPPLPPRPPHLIEFPPSPPPSPGPMHMVVCMPA HLIEFPPSPPPSPGP 21.818 (322) 542/2881) score = 27.457 21.818 (total and max score) >gi|9625705|ref|NP_039954.1| UL20 [Human herpesvirus 5 strain AD169] 1 MLGIRAMLVMLDYYWIQLITNNDTRSNNTDTIFVSLLTGANGVTRTAIGGLHSNYTNLTEAFRFTPANTTTNSSTEGNWSVTNLTESCINRGESYLTTIW 101 LLNCADNNTYWYSGNAYNHTIDTCKNTVSGYLFFGMCQLWKDWVTNASHDTVRIQSLGNEIRCMLLPRQYTLNATVEWYNKSEGDVPEEFMDYVILTPLA TVEWYNKSEGDVPEE 5.639 (182) 201 VLTCGLQEAYILDKGRRYMYLFSVSCAGITGTVSIILVSLSLLILICYYRCGRLLICPRGFELLPEFTEEEEEKEKLLTYKDIEVQVPIRTRRLLVPWIR 301 ESKMWVLPPPLPPRPPHLIEFPPSPPPSPGPMHMVVCMPA HLIEFPPSPPPSPGP 21.818 (324) 554/2881) score = 41.749 21.643 (total and max score) >gi|52139210|ref|YP_081483.1| tegument protein UL24 [Human herpesvirus 5] 1 MSDLASLALTAEFGLGCLEAYVRINAGQVLPVVWPPGWNLVLQEIETDEDFKPEDVKAWSHYLCCQTRLAFVGRFVNEGVLSPDQQKKTAVCLISDEGYV LVLQEIETDEDFKPE 12.355 (47) FVNEGVLSPDQQKKT 21.643 (82) 101 FCYVREDTAVYYLARNLMEFARVGLRAVETLHCMRYLTSSLVKRYFRPLLRAWSLGLDTMARFIIRHHGQFMPLTYPPGTELRLCNLRCFENSVEGGHLL 201 RNIKTAFGMRVLGLGTVSLKGENAPFPHLRWPVDLIPIVVAYTGAVYACDVRDDRYIRVGDNLNTFMCLGLNLLFENRRFSGHNGIYDRVPDCPKGRQHR FSGHNGIYDRVPDCP 7.750 (287) 555/2881) score = 41.749 21.643 (total and max score) >gi|28373246|ref|NP_783778.1| UL24 [Human herpesvirus 5 strain AD169] 1 MSDLASLALTAEFGLGCLEAYVRINAGQVLPVVWPPGWNLVLQEIETDEDFKPEDVKAWSHYLCCQTRLAFVGRFVNEGVLSPDQQKKTAVCLISDEGYV LVLQEIETDEDFKPE 12.355 (47) FVNEGVLSPDQQKKT 21.643 (82) 101 FCYVREDTAVYYLARNLMEFARVGLRAVETLHCMRYLTSSLVKRYFRPLLRAWSLGLDTMARFIIRHHGQFMPLTYPPGTELRLCNLRCFENSVEGGHLL 201 RNIKTAFGMRVLGLGTVSLKGENAPFPHLRWPVDLIPIVVAYTGAVYACDVRDDRYIRVGDNLNTFMCLGLNLLFENRRFSGHNGIYDRVPDCPKGRQHR FSGHNGIYDRVPDCP 7.750 (287) 558/2881) score = 191.186 21.565 (total and max score) >gi|52139305|ref|YP_081580.1| protein UL135 [Human herpesvirus 5] 1 MVWLWLGVGLLGGTGLASLVLAISLFTQRRGRKRSDETSSRGRLPGAASDKRGACACCYRIPKEDVVEPLDLELGLMRVATHPPTPQVPRCTSLYIGEDG QRRGRKRSDETSSRG 14.138 (35) QRRGRKRSDETSSRG 13.553 (35) QRRGRKRSDETSSRG 5.179 (35) 101 LPIDKPEFPPARFEIPDVSTPGTPTSIGRSPSHCSSSSSLSSSASVDTVLHQPPPSWKPPPPPGRKKRPPTPPVRAPTTRLSSHRPPTPIPAPRKNLSTP PDVSTPGTPTSIGRS 21.565 (123) APRKNLSTPPTKKTP 17.486 (199) GRSPSHCSSSSSLSS 3.986 (135) GRKKRPPTPPVRAPT 14.507 (171) STPPTKKTPPPTKPK 13.121 (205) TSIGRSPSHCSSSSS 2.868 (132) GRKKRPPTPPVRAPT 13.699 (171) STPPTKKTPPPTKPK 4.524 (205) GRKKRPPTPPVRAPT 11.076 (171) APRKNLSTPPTKKTP 7.177 (199) APRKNLSTPPTKKTP 6.176 (199) 201 PTKKTPPPTKPKPVGWTPPVTPRPFPKTPTPQKPPRNPRLPRTVGLENLSKVGLSCPCPRPRTPTEPTTLPIVSVSELAPPPRWSDIEELLEKAVQSVMK TPRPFPKTPTPQKPP 19.940 (228) KPKPVGWTPPVTPRP 15.115 (217) KPKPVGWTPPVTPRP 7.074 (217) 301 DAESMQMT 567/2881) score = 238.186 21.400 (total and max score) >gi|52139278|ref|YP_081553.1| protein UL112 [Human herpesvirus 5] 1 MDLPTTVVRKYWTFTNPNRILHQSVNQTFDVRQFVFDNARLVNCVDGDGKVLHLNKGWLCATIMQHGEASAGAKTQQGFMSIDITGDGELQEHLFVRGGI 101 VFNKSVSSVVGSSGPNESALLTMISENGNLQVTYVRHYLKNHGESSGGGGGCGAASTASAVCVSSLGGSGGTRDGPSAEEQQRRRQEQRHEERRKKSSSS HEERRKKSSSSAGGG 21.400 (197) EERRKKSSSSAGGGG 14.534 (198) ERRKKSSSSAGGGGG 14.019 (199) RRKKSSSSAGGGGGG 4.206 (200) 201 AGGGGGGGASGGGGGGGSGGQHSSDSANGLLRDPRLMNRQKERRPPPSSENDGSPPLREAKRQKTTAQHEGHGGGGKNETEQQSGGAGGGGGGGSGRMSL PSSENDGSPPLREAK 19.647 (254) ERRPPPSSENDGSPP 6.378 (249) PSSENDGSPPLREAK 2.452 (254) 301 PLDTSEAVAFLNYSSSSSAVSSSSNNHHHHHHHHNAVTDVAAGTDGALLLPIERGAVVSSPSSTSPSSLLSLPRPSSAHSAGETVQESEAAATAAAAGLM ERGAVVSSPSSTSPS 13.109 (360) 401 MMRRMRRAPAEAAEAPPQSEEENDSTTPVSNCRVPPNSQESAAPQPPRSPRFDDIIQSLTKMLNDCKEKRLCDLPLVSSRLLPETSGGTVVVNHSSVART EEENDSTTPVSNCRV 16.102 (427) AAEAPPQSEEENDST 8.374 (419) 501 AAAVSTAGVGPPAVACPPLVTTGVVPSGSVAGVAPVAAAVETPAAPPRPVCEIKPYVVNPVVATAAAASNSSSSSSAPLPPPPPPPGGRRGRARNNTRGG 601 GGGGGGGRNSRRQAASSSSSSSRRSRRRNNRHEDEDNDPLLRLSQVAGSGRRRGPSFLEDGLEIIDPSEEAAIAAASIAAFFDD NSRRQAASSSSSSSR 20.832 (616) RRQAASSSSSSSRRS 16.081 (618) RQAASSSSSSSRRSR 14.656 (619) SRRQAASSSSSSSRR 14.457 (617) NSRRQAASSSSSSSR 13.543 (616) AASSSSSSSRRSRRR 13.123 (621) QAASSSSSSSRRSRR 12.706 (620) SSSSSRRSRRRNNRH 12.568 (625) 568/2881) score = 238.186 21.400 (total and max score) >gi|9625801|ref|NP_040050.1| UL112 [Human herpesvirus 5 strain AD169] 1 MDLPTTVVRKYWTFANPNRILHQSVNQTFDVRQFVFDTARLVNCVDGDGKVLHLNKGWLCATIMQHGEASAGAKTQQGFMSIDITGDGELQEHLFVRGGI 101 VFNKSVSSVVGSSGPNESALLTMISENGNLQVTYVRHYLKNHGESSSGGGGCGAASTASAVCVSSLGGSGGTRDGPSAEEQQRRRQEQRHEERRKKSSSS HEERRKKSSSSAGGG 21.400 (197) EERRKKSSSSAGGGG 14.534 (198) ERRKKSSSSAGGGGG 14.019 (199) RRKKSSSSAGGGGGG 4.206 (200) 201 AGGGGGGGAGGGGGGGGSGGQHSSDSANGLLRDPRLMNRQKERRPPPSSENDGSPPLREAKRQKTTAQHEGHGGGGKNETEQQSGGAGGGGGGGSGRMSL PSSENDGSPPLREAK 19.647 (254) ERRPPPSSENDGSPP 6.378 (249) PSSENDGSPPLREAK 2.452 (254) 301 PLDTSEAVAFLNYSSSSSAVSSSSNNHHHHHHHHNAVTDVAAGTDGALLLPIERGAVVSSPSSTSPSSLLSLPRPSSAHSAGETVQESEAAATAAAAGLM ERGAVVSSPSSTSPS 13.109 (360) 401 MMRRMRRAPAEAAEAPPQSEEENDSTTPVSNCRVPPNSQESAAPQPPRSPRFDDIIQSLTKMLNDCKEKRLCDLPLVSSRLLPETSGGTVVVNHSSVART EEENDSTTPVSNCRV 16.102 (427) AAEAPPQSEEENDST 8.374 (419) 501 AAAVSAAGVGPPAAACPPLVTTGVVPSGSVAGVAPVAAAIETPAAPPRPVCEIKPYVVNPVVATAAAASNSSSSSSAPLPPPPPPSGGRRGRARNNTRGG 601 GGGGGGRNSRRQAASSSSSSSRRSRRRNNRHEDEEDNDPLLRLSQVAGNGRRRGPSFLEDGLEIIDPSEEAAIAAASIAAFFDD NSRRQAASSSSSSSR 20.832 (615) RRQAASSSSSSSRRS 16.081 (617) RQAASSSSSSSRRSR 14.656 (618) SRRQAASSSSSSSRR 14.457 (616) NSRRQAASSSSSSSR 13.543 (615) AASSSSSSSRRSRRR 13.123 (620) QAASSSSSSSRRSRR 12.706 (619) SSSSSRRSRRRNNRH 12.568 (624) 591/2881) score = 151.902 21.236 (total and max score) >gi|9625757|ref|NP_040006.1| UL72 [Human herpesvirus 5 strain AD169] 1 MLTMLTDRIDSQLVLSRLPRSRFQRFWETPTLIMKEESASSSGSIILAEKSVNMRYCVRFASDSDFQTTFTLPQSTEEKYDKEQHPGEDEASSPLPSPLK IMKEESASSSGSIIL 19.003 (40) PGEDEASSPLPSPLK 13.062 (93) PQSTEEKYDKEQHPG 9.338 (80) EASSPLPSPLKVPYK 7.474 (97) PGEDEASSPLPSPLK 6.143 (93) 101 VPYKWMPSSFIVKQCHTQLAFYNKHIIWLSRERKVPTSLGVSLYIPEGFFGITFYKCLDAQFVCMPELLESRLQVPQLDVVNLNDTFQSIFPGTIEGDIG 201 VFPCFVPEPWQLMNLPPPNEHRFFSLRTRQTLVIGPGHTQTVYFDAAYVHAPGICALIVGVRQFSQSDLIIRPTIWLPGTAAGVTVVNTSHTTVCISPHT 301 TVAKAVFTTHRFTYLPVGSHPLGQMIVPPTPDIGFTHTPEHALLQRTPSPVDDDVDETEEDEKSSDAESPVNTNDVIFDVGPKPPRHP EKSSDAESPVNTNDV 21.236 (369) ALLQRTPSPVDDDVD 19.420 (349) TEEDEKSSDAESPVN 19.351 (365) TEEDEKSSDAESPVN 17.897 (365) VDDDVDETEEDEKSS 14.938 (358) ALLQRTPSPVDDDVD 4.041 (349) 620/2881) score = 167.168 20.938 (total and max score) >gi|52139265|ref|YP_081540.1| DNA packaging tegument protein UL17 [Human herpesvirus 5] 1 METHLYSDLAFEARFADDEQLPLHLVLDQEVLSNEEAETLRYVYYRNVDSAGRSAGRVPSGDEDDAPASDDAEDAVGGDRAFDRERRTWQRACFRVLPRP RSAGRVPSGDEDDAP 20.938 (60) DEDDAPASDDAEDAV 18.159 (69) VYYRNVDSAGRSAGR 12.350 (50) RSAGRVPSGDEDDAP 8.405 (60) 101 LELLDYLRQSGLTVTLEKEQRVRMFYAVFTTLGLRCPDNRLSGAQTLHLRLVWPDGSYRDWEFLARDLLREEMEANKRDRQHQLATTTNHRRRGGLRNNL 201 DNGSDRRLPEAAVASLETAVSTPFFEIPNGAGTSSANGGGRFSNLEQRVARLLRGDEEFIYHAGPLEPPSKIRGHELVQLRLDVNPDLMYATDPHDRDEV RGDEEFIYHAGPLEP 20.163 (261) 301 ARTDEWKGAGVSRLREVWDVQHRVRLRVLWYVNSFWRSRELSYDDHEVELYRALDAYRARIAVEYVLIRAVRDEIYAVLRRDSGALPQRFACHVPRNMSW FWRSRELSYDDHEVE 15.993 (342) RAVRDEIYAVLRRDS 17.002 (376) YVNSFWRSRELSYDD 13.557 (338) DDHEVELYRALDAYR 7.669 (351) 401 RVVWELCRHALALWMDRADVRSCIIKALTPRLSRGAAAAAQRARRQRERSAPKPQELLFGPRNESGPPAERTWYADVVRCVRTQVDLGVEVRAARCPRTG 501 LWIVRDRRGRLRRWLSQPEVCVLYVTPDLDFYWVLPGGFAVSSRVTLHGLAQRALRDRFQNFEAVLARGMHVEAGRQEPETPRVSGRRLPFDDL GRLRRWLSQPEVCVL 17.662 (516) AGRQEPETPRVSGRR 15.271 (581) 661/2881) score = 101.533 20.517 (total and max score) >gi|52139230|ref|YP_081503.1| ribonucleotide reductase subunit 1 [Human herpesvirus 5] 1 MNPADADEEQRVSSVPAHRCRPGRIPSRSAETETEESSAEVAADTIGGDDSELEEGPLPGGDKEASAGNTNVSSGVACVAGFTSGGGVVSWRPESPSPDG PGRIPSRSAETETEE 17.593 (29) SWRPESPSPDGTPSV 15.983 (97) AETETEESSAEVAAD 13.817 (37) CRPGRIPSRSAETET 12.837 (27) DTIGGDDSELEEGPL 4.264 (51) 101 TPSVLSLTRDSGPAVPSRGGRVSSGLSTFNPAGATRMELDSVEEEDDFGASLCKVSPPIQAMRMLMGKKCHCHGYWGKFRFCGVQEPARELPSDRNALWR ATRMELDSVEEEDDF 20.517 (141) ATRMELDSVEEEDDF 7.117 (141) ATRMELDSVEEEDDF 4.736 (141) 201 EMDTVSRHSAGLGSFRLFQLIMRHGPCLIRHSPRCDLLLGRFYFKANWARESRTPLCYASELCDESVRRFVLRHMEDLPKLAEETARFVELAGCWGLYAA 301 ILCLDKVCRQLHGQDESPGGVFLRIAVALTAAIENSRHSRIYRFHLDARFEGEVLESVLKRCRDGQLSLSTFTMSTVGFDRVPQYDFLISADPFSRDASW 401 AAMCKWMSTLSCGVSVSVNVTRLNADVNSVIRCLGGYCDLIREKEVHRPVVRVFVDMWDVAAIRVINFILKESTSELTGVCYAFNVPSVLMKRYRAREQR 501 YSLFGRPVSRRLSDLGQESAFEKEYSRCEQSCPKVVVNTDDFLKKMLLCALKGRASVVFVHHVVKYSIMADSVCLPPCLSPDMASCHFGECDMPVQRLTV RPVSRRLSDLGQESA 4.670 (513) 601 NVARCVFARSDEQKLHLPDVVLGNTRRYFDLSVLRELVTEAVVWGNARLDALMSASEWWVESALEKLRPLHIGVAGLHTALMRLGFTYFASWDLIERIFE 701 HMYFAAVRASVDLCKSGLPRCEWFERTIYQEGKFIFELYRLPRLSIASARWEALRADMLEFGLRNCQFLAVGPDDEVAHLWGVTPSVWASRGTVFEEETV 801 WSLCPPNRECYFPTVVRRPLRVPVVNYAWLEQHQEEGKATQCLFQAAPAIQNDVEMAAVNLSVFVDQCVALVFYYDSGMTPDVLLARMLKWYHWRFKVGV 901 YKYCAS 662/2881) score = 101.533 20.517 (total and max score) >gi|9625730|ref|NP_039979.1| UL45 [Human herpesvirus 5 strain AD169] 1 MNPADADEEQRVSSVPAHRCRPGRIPSRSAETETEESSAEVAADTIGGDDSELEEGPLPGGDKEASAGNTNVSSGVACVAGFTSGGGVVSWRPESPSPDG PGRIPSRSAETETEE 17.593 (29) SWRPESPSPDGTPSV 15.983 (97) AETETEESSAEVAAD 13.817 (37) CRPGRIPSRSAETET 12.837 (27) DTIGGDDSELEEGPL 4.264 (51) 101 TPSVLSLTRDSGPAVPSRGGRVSSGLSTFNPAGATRMELDSVEEEDDFGASLCKVSPPIQATRMLMGKKCHCHGYWGKFRFCGVQEPARELPSDRNALWR ATRMELDSVEEEDDF 20.517 (141) ATRMELDSVEEEDDF 7.117 (141) ATRMELDSVEEEDDF 4.736 (141) 201 EMDTVSRHSAGLGSFRLFQLIMRHGPCLIRHSPRCDLLLGRFYFKANWARESRTPLCYASELCDESVRRFVLRHMEDLPKLAEETARFVELAGCWGLYAA 301 ILCLDKVCRQLHGQDESPGGVFLRIAVALTAAIENSRHSRIYRFHLDARFEGEVLESVLKRCRDGQLSLSTFTMSTVGFDRVPQYDFLISADPFSRDASW 401 AAMCKWMSTLSCGVSVSVNVTRLNADVNSVIRCLGGYCDLIREKEVHRPVVRVFVDMWDVAAIRVINFILKESTSELTGVCYAFNVPSVLMKRYRAREQR 501 YSLFGRPVSRRLSDLGQESAFEKEYSRCEQSCPKVVVNTDDFLKKMLLCALKGRASVVFVHHVVKYSIMADSVCLPPCLSPDMASCHFGECDMPVQRLTV RPVSRRLSDLGQESA 4.670 (513) 601 NVARCVFARSDEQKLHLPDVVLGNTRRYFDLSVLRELVTEAVVWGNARLDALMSASEWWVESALEKLRPLHIGVAGLHTALMRLGFTYFASWDLIERIFE 701 HMYFAAVRASVDLCKSGLPRCEWFERTIYQEGKFIFELYRLPRLSIASARWEALRADMLEFGLRNCQFLAVGPDDEVAHLWGVTPSVWASRGTVFEEETV 801 WSLCPPNRECYFPTVVRRPLRVPVVNYAWLEQHQEEGKATQCLFQAAPAIQNDVEMAAVNLSVFVDQCVALVFYYDSGMTPDVLLARMLKWYHWRFKVGV 901 YKYCAS 664/2881) score = 51.524 20.500 (total and max score) >gi|52139249|ref|YP_081524.1| nuclear protein UL24 [Human herpesvirus 5] 1 MPSGCGDDADSTGNALRRLPHVRKRIGKRKHLDIYRRLLRVFPSFVALNRLLGGLFPPELQKYRRRLFIEVRLSRRIPDCVLVFLPPDSGSRGIVYCYVI IEFKTTYSDADDQSV 7.917 (107) 101 EFKTTYSDADDQSVRWHATHSLQYAEGLRQLKGALVDFDFLRLPRGGGQVWSVVPSLVFFQQKADRPSFYRAFRSGRFDLCTDSVLDYLGRRQDESVAHL 201 LAATRRRLLRAARGKRAALPRARASAVAGGRGGGNARRGLARGRAHGPGAQTVSASGAEGSGSQGTDLLRGSRRARVRGGGAVEPAVRARRRTVAADAAT SGAEGSGSQGTDLLR 20.500 (263) SGAEGSGSQGTDLLR 8.810 (263) 301 TTVSSAFVVPRDRRGRSFRRPTRSL PRDRRGRSFRRPTRS 14.298 (317) 684/2881) score = 40.668 20.355 (total and max score) >gi|52139300|ref|YP_081575.1| membrane glycoprotein UL141 [Human herpesvirus 5] 1 MCRRESLRTLPWLFWVLLSCPRLLEYSSSSFPFATADIAEKMWAENYETTSPAPVLVAEGEQVTIPCTVMTHSWPMVSIRARFCRSHDGSDELILDAVKG EKMWAENYETTSPAP 8.825 (47) IRARFCRSHDGSDEL 20.355 (86) 101 HRLMNGLQYRLPYATWNFSQLHLGQIFSLTFNVSTDTAGMYECVLRNYSHGLIMQRFVILTQLETLSRPDEPCCTPALGRYSLGDQIWSPTPWRLRNHDC 201 GMYRGFQRNYFYIGRADAEDCWKPACPDEEPDRCWTVIQRYRLPGDCYRSQPHPPKFLPVTPAPPADIDTGMSPWATRGIAAFLGFWSIFTVCFLCYLCY 301 LQCCGRWCPTPGRGRRGGEGYRRLPTYDSYPGVKKMKR GYRRLPTYDSYPGVK 11.488 (327) 688/2881) score = 43.976 20.297 (total and max score) >gi|52139182|ref|YP_081455.1| protein RL1 [Human herpesvirus 5] 1 MPATDTNSTHTTPLHPEDQHTLPLHHSTTQPHVQTSDKHADKQHRTQMELDAADYAACAQARQHLYGQTQPQLHAYPNANPQESAHFRTENQHQLTNLLH 101 NIGEGAALGYPVPRAEIRRGGGDWADSASDFDADCWCMWGRFGTMGRQPVVTLLLARQRDGLADWNVVRCRGTGFRAHDSEDGVSVWRQHLVFLLGGHGR GGGDWADSASDFDAD 13.301 (127) GDWADSASDFDADCW 7.475 (129) 201 RVQLERPSAGEAQARGLLPRIRITPISTSPRPKPPQPTTSTASHPHATARPDHTLFPVPSTPSATVHNPRNYAVQLHAETTRTWRWARRGERGAWMPAET RITPISTSPRPKPPQ 20.297 (229) TLFPVPSTPSATVHN 2.903 (261) 301 FTCPKDKRPW 694/2881) score = 106.294 20.224 (total and max score) >gi|52139333|ref|YP_081608.1| protein US23 [Human herpesvirus 5] 1 MWRTRWEDGAPTFTRNDEFLYCHTRYETFLRVMGDFQGIFECQYSADVLRDWVRNHVDQVLSLGIPHNWFLQVRPGSTMPELRDQLLDDVICCPERLIVL 101 GKCVIMVDDHYEETELVLCMGGGTRLYIYEPSQEILLLCARHLDELARYGMMYTEAVYRQPQTPFATRVPHDVVAMLLRHGHDTDALAACVGEHHGRDVN VIMVDDHYEETELVL 7.737 (111) MMYTEAVYRQPQTPF 13.638 (158) 201 FHTPGRHAKTLKLLTSFGCLTDCWPFEVAPAARLAECEMYVTLQLRCRWYLLGAVGSYRAGGFFDTSFLIIFDRFCRFYVVIVKSHLDRSPPLQRLAGEI 301 YRLADSLEELFRAGLMKVYVRRRYEHGLRRAARLERNGGCVHMGEAARLHFTMFDSGVDRDYARQFRWLCRGDRFRAEMLNNWDGWDAFTIWQARVVRGD 401 FAERRRPRSLGDGEEEDEGNDGRAMPVVRRRPPPMPRDDDEDNHVVPDNQNLEVIHDALADDEEQGEDDDDSGAEPMEPEENNVVPNVDRRGGEDAVAAR AERRRPRSLGDGEEE 20.224 (409) QGEDDDDSGAEPMEP 12.791 (472) RMAAGHESDDDEWED 18.504 (507) AERRRPRSLGDGEEE 15.976 (409) RMAAGHESDDDEWED 14.677 (507) 501 MAAGHESDDDEWEDLGFDLEEDTVFDLKDVDEWFEQRRLAEKERWHLGQRIVNAYRTEAEVSEAEVEARRINLNTDLSPEWVKSFDFREHFV YRTEAEVSEAEVEAR 2.747 (562) 695/2881) score = 97.579 20.224 (total and max score) >gi|9625859|ref|NP_040108.1| US23 [Human herpesvirus 5 strain AD169] 1 MWRTRWEDGAPTFTRNDEFLYCHTRYETFLRVMGDFQGIFECQYSADVLRDWVRNHVDQVLSLGIPHNWFLQVRPGSTMPELRDQLLDDVICCPERLIVL 101 GKCVIMVEDHYEETELVLCMGGGTRLYIYEPSQEILLLCARHLDELARYGMMYTEAVYRQPQTPFATRVPHDVVAMLLRHGHDADALAACVGEHHGRDVN VIMVEDHYEETELVL -0.978 (111) MMYTEAVYRQPQTPF 13.638 (158) 201 FHTPGRHAKTLKLLTSFGCLTDCWPFEVAPAARLAECEMYVTLQLRCRWYLLGAVGSYRAGGFFDTSFLIIFDRFCRFYVVIVKSHLDRSPPLQRLAGEI 301 YRLADSLEELFRAGLMKVYVRRRYEHGLRRAARLERNGGCVHMGEAARLHFTMFDSGVDRDYARQFRWLCRGDRFRAEMLNNWDGWDAFTIWQARVVRGD 401 FAERRRPRSLGDGEEEDEGNDGRAMPVVRRRPPPMPRDDDEDNHVVPDNQNLEVIHDALADDEEQGEDDDDSGAEPMEPEENNVVPNVERRGGEDAVAAR AERRRPRSLGDGEEE 20.224 (409) QGEDDDDSGAEPMEP 12.791 (472) RMAAGHESDDDEWED 18.504 (507) AERRRPRSLGDGEEE 15.976 (409) RMAAGHESDDDEWED 14.677 (507) 501 MAAGHESDDDEWEDLGFDLEEDTVFDLKDVDEWFEQRRLAEKERWHLGQRIVNAYRTEAEVSEAEVEARRINLNTDLSPEWVKSFDFREHFV YRTEAEVSEAEVEAR 2.747 (562) 701/2881) score = 140.030 20.163 (total and max score) >gi|9625779|ref|NP_040028.1| UL93 [Human herpesvirus 5 strain AD169] 1 METHLYSDLAFEARFADDEQLPLHLVLDQEVLSNEEAETLRYVYYRNVDSAGRSTGRAPGGDEDDAPASDDAEDAVGGDRAFDRERRTWQRACFRVLPRP DEDDAPASDDAEDAV 18.159 (69) VYYRNVDSAGRSTGR 13.869 (50) 101 LELLDYLRQSGLTVTLEKEQRVRMFYAVFTTLGLRCPDNRLSGAQTLHLRLVWPDGSYRDWEFLARDLLREEMEANKRDRQHQLATTTNHRRRGGLRNNL 201 DNGSDRRLPEAAVASLETAVSTPFFEIPNGAGTSSANGDGRFSNLEQRVARLLRGDEEFIYHAGPLEPPSKIRGHELVQLRLDVNPDLMYATDPHDRDEV RGDEEFIYHAGPLEP 20.163 (261) 301 ARTDEWKGAGVSRLREVWDVQHRVRLRVLWYVNSFWRSRELSYDDHEVELYRALDAYRARIAVEYVLIRAVRDEIYAVLRRDGGALPQRFACHVSRNMSW FWRSRELSYDDHEVE 15.993 (342) RAVRDEIYAVLRRDG 17.688 (376) YVNSFWRSRELSYDD 13.557 (338) DDHEVELYRALDAYR 7.669 (351) 401 RVVWELCRHALALWMDWADVRSCIIKALTPRLSRGAAAAAQRARRQRERSAPKPQELLFGPRNESGPPAEQTWYADVVRCVRAQVDLGVEVRAARCPRTG 501 LWIVRDRRGRLRRWLSQPEVCVLYVTPDLDFYWVLPGGFAVSSRVTLHGLAQRALRDRFQNFEAVLARGMHVEAGRQEPETPRVSGRRLPFDDL GRLRRWLSQPEVCVL 17.662 (516) AGRQEPETPRVSGRR 15.271 (581) 708/2881) score = 85.645 20.122 (total and max score) >gi|52139269|ref|YP_081544.1| tegument serine/threonine protein kinase [Human herpesvirus 5] 1 MSSALRSRARSASLGTTTQGWDPPPLRRPSRARRRQWMREAAQAAAQAAVQAAQAAAAQVAQAHVDEDEVVDLMTDEAGGGVTTLTTLSSVSTTTVLGHA RSRARSASLGTTTQG 3.119 (13) 101 TFSACVRSDVMRDGEKEDAASDKENQRRPVVPSTSSRGSAASGDGYHGLRCRETSAMWSFEYDRDGDVTSVRRALFTGGSDPSDSVSGVRGGRKRPLRPP RPVVPSTSSRGSAAS 14.003 (135) GEKEDAASDKENQRR 10.745 (121) RETSAMWSFEYDRDG 2.202 (159) SAASGDGYHGLRCRE 7.688 (146) 201 LVSLARTPLCRRRVGGVDAVLEENDVELRAESQDSAVASGPGRVPQPLSGSSGEESATAVEADSTSHDDVHCTCSNDQIITTSIRGLTCDPRMFLRLTHP GRVPQPLSGSSGEES 20.122 (249) VPQPLSGSSGEESAT 12.856 (251) DVELRAESQDSAVAS 5.445 (232) PQPLSGSSGEESATA 5.007 (252) GRVPQPLSGSSGEES 4.457 (249) 301 ELCELSISYLLVYVPKEDDFCHKICYAVDMSDESYRLGQGSFGEVWPLDRYRVVKVARKHSETVLTVWMSGLIRTRAAGEQQQPPSLVGTGVHRGLLTAT 401 GCCLLHNVTVHRRFHTDMFHHDQWKLACIDSYRRAFCTLADAIKFLNHQCRVCHFDITPMNVLIDVNPHNPSEIVRAALCDYSLSEPYPDYNERCVAVFQ 501 ETGTARRIPNCSHRLRECYHPAFRPMPLQKLLICDPHARFPVAGLRRYCMSELSALGNVLGFCLMRLLDRRGLDEVRMGTEALLFKHAGAACRALENGKL 601 THCSDACLLILAAQMSYGACLLGEHGAALVSHTLRFVEAKMSSCRVRAFRRFYHECSQTMLHEYVRKNVERLLATSDGLYLYNAFRRTTSIICEEDLDGD 701 CRQLFPE 736/2881) score = 49.905 19.800 (total and max score) >gi|52139303|ref|YP_081578.1| protein UL138 [Human herpesvirus 5] 1 MDDLPLNVGLPIIGVMLVLIVAILCYLAYHWHDTFKLVRMFLSYRWLIRCCELYGEYERRFADLSSLGLGAVRRESDRRYRFSERPDEILVRWEEVSSQC 101 SYASSRITDRRAGSSSSSSVHVANQRNSVPPPDMAVTAPLTDVDLLKPVTGSATQFTTVAMVHYHQEYT ITDRRAGSSSSSSVH 19.800 (114) DRRAGSSSSSSVHVA 15.271 (116) ITDRRAGSSSSSSVH 12.348 (114) RRAGSSSSSSVHVAN 2.486 (117) 747/2881) score = 95.473 19.717 (total and max score) >gi|52139311|ref|YP_081586.1| protein UL150 [Human herpesvirus 5] 1 MLTLYLFTATCCFVCALPRQAQVDTAICHHTWPMCSDVPHPTSSAHNTALSSSHAISIEHRLLHSPSPPRENIRHSMRCRRRAIASSASTPVSHTQPLAA IEHRLLHSPSPPREN 15.873 (65) AIASSASTPVSHTQP 14.366 (90) HRLLHSPSPPRENIR 8.415 (67) 101 NHRRSRITYATTDPTNSPTASPAKSDKLEADADPALHRRPDSLLRHLFQPCHAQRGTSNRATSQRASLNAVHHKLCGAMISSSWSTTCTPAIMDLPSLSV ATTDPTNSPTASPAK 19.717 (117) PTNSPTASPAKSDKL 13.002 (121) PTNSPTASPAKSDKL 5.574 (121) ATTDPTNSPTASPAK 5.336 (117) PTNSPTASPAKSDKL 2.974 (121) 201 ELSAGHKKKETPTEGGWGGEEGEDDVLATIRNTLSAPTSPAAATTHRLSFPEGSSFCLTAVSEYSQRLTSTAALTPPPPAVAAPFSFSSTVSETGAFPQS 301 TAGRTRVDDTAVVTAGDPRSPVTHVTLLQIFRLRSSLLTSRSGDTLRGGEHEAIPKVASLFWTLLKATQTVEITHKTPSADSHRNPQKYTDRPQRLLLTA 401 LAIWQRTYNNTRADHAPQVRLLGNILTYRRPQTATASAKAHTQQQPEEPKGQQIWAQTAGQAAPHGDEPHSDGELRRESHSAPPTSRTLPDTILAVKRRS PHGDEPHSDGELRRE 6.076 (471) DGELRRESHSAPPTS 4.140 (479) 501 VAQRSHVRLDAKPGLNDRDGFRRRLLLPLSGYFRANELRNQQFMGYGTENGLKNTCLTRPLGAAGGVRETIGERQDRDVADSATQRVFHTLYAALQTVRV 601 WYTALGTAWRTSGSRTRDSLFDGPRRRDRQAGRLRRLEL 752/2881) score = 25.325 19.636 (total and max score) >gi|52139197|ref|YP_081470.1| protein UL10 [Human herpesvirus 5] 1 MRQLINHIVNHDLFRWSVVTAMIFYRYSETCMEVTVRVGDPVTLGSGHGYHPGQKVHWYNQSCVGIGNGENTHPICTYDPPKPGRQKTMKTTPLPSPLLY NTHPICTYDPPKPGR 2.558 (78) 101 ECHNSTLSILHVNVSDPRNYCRRKCPPKGNCEFPTCFTLSLISRTTTRKPEQKTTLLRLKTTPNKHTQHKRSTRRTSPKDYNVTGLPKGFADSFTGNVEA KRSTRRTSPKDYNVT 19.636 (177) KRSTRRTSPKDYNVT 3.131 (177) 201 HRTKDAAHSAWILIIIIIIIVVILFFFKIPQRLREKWDTKGYLYKGTDGLPTTD 755/2881) score = 52.515 19.599 (total and max score) >gi|9625723|ref|NP_039972.1| UL38 [Human herpesvirus 5 strain AD169] 1 MTTTTHSTAAIMSLLDEAEWRQTQMDVGGLIQASALGKVALRYAVRKLMKRGARLRHDSGLYVCICDPSYEFLQMNLSKISWLERHCPPLDQELIMFGVI 101 EAWEEASVRPTRQLVLFMTPKWDVFAYDSGILFFLAPSMAQFWHGAIVLEYWNALFPVEVRSHVRQHAHTMDDLVMVFHQLDYEKQVLEARRDKNTEGPR 201 TFAKSVNSYVRAILESERRIREGKIPMTFVDRDSLRANSLAHIQATGAQPSHAPAQRVLSAPPSLPLPVSEEDPAAAATPSSSAATTPPSSVVPASVESE PSSSAATTPPSSVVP 19.599 (287) VESELSSSPPLPPVV 16.032 (304) ASVESELSSSPPLPP 14.410 (302) PSSSAATTPPSSVVP 2.474 (287) 301 LSSSPPLPPVVVKDVVYTAGEGDVVQMVVVV 762/2881) score = 42.810 19.561 (total and max score) >gi|52139205|ref|YP_081478.1| protein UL19 [Human herpesvirus 5] 1 MTSNALYELFRRRLPRAPVNTVMFLTRRTRDGFCGRLTSIATNSHYTMFVLDHGSVRIERPSQSEVDCASLMETLKRIRLRNSWVASEDELDVSRRDA SVRIERPSQSEVDCA 19.561 (62) KRIRLRNSWVASEDE 18.932 (83) LRNSWVASEDELDVS 4.316 (87) 763/2881) score = 42.810 19.561 (total and max score) >gi|9625704|ref|NP_039953.1| UL19 [Human herpesvirus 5 strain AD169] 1 MTSNALYELFRRRLPRAPVNTVMFLTRRTRDGFCGRLTSIATNSHYTMFVLDHGSVRIERPSQSEVDCASLMETLKRIRLRNSWVASEDELDVSRGDA SVRIERPSQSEVDCA 19.561 (62) KRIRLRNSWVASEDE 18.932 (83) LRNSWVASEDELDVS 4.316 (87) 767/2881) score = 101.403 19.516 (total and max score) >gi|9625791|ref|NP_040039.1| UL104 [Human herpesvirus 5 strain AD169] 1 MERNHWNEKSSGAKRSRERDLTLSTIRSILAADERLRIKASSYLGVGRGVDDEAVIDIFPTGQTMSFLRLLHGFLGTCRGQSMHQVLRDPCVLRKQLLYG 101 VCKTLFDTITVRRVAEEWKLHAALFPYRALDEEDLEQYLLVWSASLRQSVQTGVLGGLRDILYQYADNDDYGLYVDWCVTVGLVPLLDVKTKPSEAAERA 201 QFVRAAVQRATETHPLAQDLLQANLALLLQVAERLGAVRVANAPEVRVFKKVRSERLEAQLRGKHIRLYVAAEPLAYERDKLLFTTPVAHLHEEILRYDG RDKLLFTTPVAHLHE 12.420 (286) 301 LCRHQKICQLLNTFPVKVVTASRHELNCKKLVEMMEQHDRGSDAKKSIMKFLLNVSDSKSRIGIEDSVESFLQDLTPSLVDQNRLLPARGPGGPGVVGPG 401 GAVVGGPAGHVGLLPPPPGPAAPERDIRDLFKKQVIKCLEEQIQSQVDEIQDLRTLNQTWENRVRELRDLLTRYASRREDSMSLGARDAELYHLPVLEAV CLEEQIQSQVDEIQD 19.516 (445) DLLTRYASRREDSMS 18.723 (476) YASRREDSMSLGARD 17.605 (481) 501 RKARDAAPFRPLAVEDNRLVANSFFSQFVPGTESLERFLTQLWENEYFRTFRLRRLVTHQGAEEAIVYSNYTVERVTLPYLCHILALGTLDPVPEAYLQL GAEEAIVYSNYTVER 8.615 (568) 601 SFGEIVAAAYDDSKFCRYVELICSREKARRRQMSREAAGGVPERGTASSGGPGTLERSAPRRLITADEERRGPERVGRFRNGGPDDPRRAGGPYGFH KARRRQMSREAAGGV 12.338 (634) GEIVAAAYDDSKFCR 12.186 (610) 768/2881) score = 101.403 19.516 (total and max score) >gi|52139275|ref|YP_081550.1| capsid portal protein [Human herpesvirus 5] 1 MERNHWNEKSSGAKRSRERDLTLSTIRSILAADERLRIKASSYLGVGRGVDDEAVIDIFPTGQTMSFLRLLHGFLGTCRGQSMHQVLRDPCVLRKQLLYG 101 VCKTLFDTITVRRVAEEWKLHAALFPYRALDEEDLEQYLLVWSASLRQSVQTGVLGALRDILYQYADNDDYGLYVDWCVTVGLVPLLDVKTKPSEAAERA 201 QFVRAAVQRATETHPLAQDLLQANLALLLQVAERLGAVRIANAPEVRVFKKVRSERLEAQLRGKHIRLYVAAEPLAYERDKLLFTTPVAHLHEEILRYDG RDKLLFTTPVAHLHE 12.420 (286) 301 LCRHQKICQLLNTFPVKVVTASRHELNCKKLVEMMEQHDRGSDAKKSIMKFLLNVSDSKSRIGIEDSVESFLQDLTPSLVDQNRLLPARGPGGPGVVGPG 401 GAVVGGPAGHVGLLPPPPGPAAPERDIRDLFKKQVIKCLEEQIQSQVDEIQDLRTLNQTWENRVRELRDLLTRYASRREDSMSLGARDAELYHLPVLEAV CLEEQIQSQVDEIQD 19.516 (445) DLLTRYASRREDSMS 18.723 (476) YASRREDSMSLGARD 17.605 (481) 501 RKARDAAPFRPLAVEDNRLVANSFFSQFVPGTESLERFLTQLWENEYFRTFRLRRLVTHQGAEEAIVYSNYTVERVTLPYLCHILALGTLDPVPEAYLQL GAEEAIVYSNYTVER 8.615 (568) 601 SFGEIVAAAYDDSKFCRYVELICSREKARRRQMSREAAGGVPERGTASSGGPGTLERSAPRRLITADEERRGPERVGRFRNGGPDDPRRAGGPYGFH KARRRQMSREAAGGV 12.338 (634) GEIVAAAYDDSKFCR 12.186 (610) 818/2881) score = 145.438 19.133 (total and max score) >gi|9625773|ref|NP_040022.1| UL87 [Human herpesvirus 5 strain AD169] 1 MAGAAPRRLGCDALIVVGGSAMPRRVLHVPVHVRACNLTQELSTGEDARFCRPRPVNVERVRAVFAALYRACPIHVRTEPERVKLVLGRLLLGPVAVPCF HVRACNLTQELSTGE 13.408 (39) 101 CDGEVEGHGEHLVPTTQFCRGPLLYVHRRCCCGSVTAGRALSYHVLENHVATHVLRGLLSLTEWNRELPSLFCDCPGGGGASGTEERYAMACLPRDLSLH 201 LDDYPYLMVEIGRVLSVSEVDDYVTAVSGYLGEAAAPRIQVHYKLLFGLNVRPQAPCALDATRDFFLLELQKLWLGVEYHHEVTSEFFGRVLAQLHRDRA VEIGRVLSVSEVDDY 19.133 (216) SVSEVDDYVTAVSGY 9.185 (223) IGRVLSVSEVDDYVT 6.141 (218) 301 RVMMALRLPEQTVCHLSTFVLSRFKRQVLYFKLQVSYGKCRTGHADRSGGGGNGGNQGHHNLLCYRRLSVTFADTDTVWRNLFYVYYELARDLGSHGTED 401 RPVSRGYGVSCASRTSRLSPSESTVVSANGHALSSTALPTTSAGHKLSLPRDPAADRVRRYVCIISRLMYARYGERWRKHCQRRSETGEEEEEETLESGE ASRTSRLSPSESTVV 14.942 (419) ESGETDATPPFDFTG 6.768 (504) RTSRLSPSESTVVSA 14.606 (421) ASRTSRLSPSESTVV 12.700 (419) ASRTSRLSPSESTVV 6.782 (419) 501 TDATPPFDFTGQQLRRAYQEHRRRKHLAVQRYAPCRRKLIGGMEFAEVTGVSLDRIAVNAFNTNRVINMKAALSSIAASGLGVRAPRLPKNMTHSFVMYK 601 HTFKEPACTVSTFVSNDAVYINSLNVNIRGSYPEFLYSLGVYRLHVNIDHFFLPAVVCNSNSSLDVHGLEDQAVIRSERSKVYWTTNFPCMISHTNNVNV 701 GWFKAATAIVPRVSGADLEAILLKELSCIKNMRDVCIDYGLHRVFTQLELRNSYQIPFLAKQLVLFLRACLLKLHGREKRLQLDRLVFEAAQRGLFDYSK 801 NLTAHTKIKHTCALIGSRLANNVPKILARNKKVKLDHLGRNANVLTVCRHVEAHKIPRTRLKVLVEVLGALQSISGTPHTREVIHQTLFRLCSAAAATSG 901 LCSSPPPLCVSSSSSVPSVPTSVSVDGSSEPTSPRARFASR DGSSEPTSPRARFAS 17.999 (933) PSVPTSVSVDGSSEP 14.226 (924) DGSSEPTSPRARFAS 9.549 (933) 819/2881) score = 140.697 19.133 (total and max score) >gi|52139260|ref|YP_081535.1| protein UL87 [Human herpesvirus 5] 1 MAGAAPRRLGCDALIVVGGSAMPRRVLHVPVHVRACNLTQELSTGEDARFCRPRPVNVERVRAVFAALYRACPIHVRTEPERVKLVLGRLLLGPVAVPCF HVRACNLTQELSTGE 13.408 (39) 101 CDGEVEGHGEHLVPTTQFCRGPLLYVHRRCCCGSVTAGRALSYHVLENHVATHVLRGLLSLTEWNRELPSLFCDCPGGGGASGTEERYAMACLPRDLSLH 201 LDDYPYLMVEIGRVLSVSEVDDYVTAVSGYLGEAAAPRIQVHYKLLFGLNVRPQAPCALDATRDFFLLELQKLWLGVEYHHEVTSEFFGRVLAQLHRDRA VEIGRVLSVSEVDDY 19.133 (216) SVSEVDDYVTAVSGY 9.185 (223) IGRVLSVSEVDDYVT 6.141 (218) 301 RVMMALRLPEQTVCHLSTFVLSRFKRQVLYFKLQVSYGKCRTGHADRSGGGGNGGNQGHHNLLCYRRLSVTFADTDTVWRNLFYVYYELARDLGSHGTEN 401 RPVNRGYGVSCAPRTSRLSPSESTVVSANGHALSSTALPTTSAGHKLSLPRDPAADRVRRYVCIISRLMYARYGERWRKHRQRRSETGEEEEEETLESGE RTSRLSPSESTVVSA 14.606 (421) RKHRQRRSETGEEEE 13.397 (485) APRTSRLSPSESTVV 13.979 (419) ESGETDATPPFDFTG 6.768 (504) APRTSRLSPSESTVV 5.036 (419) 501 TDATPPFDFTGQQLRRAYQEHRRRKHLAVQRYAPCRRKLIGGMEFAEVTGVSLDRIAVNAFNTNRVINMKAALSSIAASGLGVRAPRLPKNMTHSFVMYK 601 HTFKEPACTVSTFVSNDAVYINSLNVNIRGSYPEFLYSLGVYRLHVNIDHFFLPAVVCNSNSSLDVHGLEDQAVIRSERSKVYWTTNFPCMISHTNNVNV 701 GWFKAATAIVPRVSGADLEAILLKELSCIKNMRDVCIDYGLHRVFTQLELRNSYQIPFLAKQLVLFLRACLLKLHGREKRLQLDRLVFEAAQRGLFDYSK 801 NLTAHTKIKHTCALIGSRLANNVPKILARNKKVKLDHLGRNANVLTVCRHVEAHKIPRTRLKVLVEVLGVLQSISGTPHTREVIHQTLFRLCSAAAATSG 901 LCSSPPPLCVSSSSSVPSVPTSVSVDGSSEPTSPRVRFASR DGSSEPTSPRVRFAS 14.568 (933) PSVPTSVSVDGSSEP 14.226 (924) DGSSEPTSPRVRFAS 10.251 (933) 831/2881) score = 112.809 19.013 (total and max score) >gi|52139241|ref|YP_081514.1| envelope glycoprotein B [Human herpesvirus 5] 1 MESRIWCLVVCVNLCIVCLGAAVSSSSTRGTSATHSHHSSHTTSAAHSRSGSVSQRVTSSQTVSHGVNETIYNTTLKYGDVVGVNTTKYPYRVCSMAQGT TSAAHSRSGSVSQRV 19.013 (50) HTTSAAHSRSGSVSQ 18.616 (48) HGVNETIYNTTLKYG 9.860 (72) AAHSRSGSVSQRVTS 5.789 (52) 101 DLIRFERNIVCTSMKPINEDLDEGIMVVYKRNIVAHTFKVRVYQKVLTFRRSYAYIHTTYLLGSNTEYVAPPMWEIHHINSHSQCYSSYSRVIAGTVFVA LLGSNTEYVAPPMWE 7.074 (168) 201 YHRDSYENKTMQLMPDDYSNTHSTRYVTVKDQWHSRGSTWLYRETCNLNCMVTITTARSKYPYHFFATSTGDVVDISPFYNGTNRNASYFGENADKFFIF 301 PNYTIVSDFGRPNSALETHRLVAFLERADSVISWDIQDEKNVTCQLTFWEASERTIRSEAEDSYHFSSAKMTATFLSKKQEVNMSDSALDCVRDEAINKL AFLERADSVISWDIQ 16.138 (330) RSEAEDSYHFSSAKM 9.060 (364) ERADSVISWDIQDEK 2.470 (333) RSEAEDSYHFSSAKM 2.096 (364) 401 QQIFNTSYNQTYEKYGNVSVFETTGGLVVFWQGIKQKSLVELERLANRSSLNLTHNRTKRSTDGNNATHLSNMESVHNLVYAQLQFTYDTLRGYINRALA 501 QIAEAWCVDQRRTLEVFKELSKINPSAILSAIYNKPIAARFMGDVLGLASCVTINQTSVKVLRDMNVKESPGRCYSRPVVIFNFANSSYVQYGQLGEDNE RDMNVKESPGRCYSR 5.561 (570) 601 ILLGNHRTEECQLPSLKIFIAGNSAYEYVDYLFKRMIDLSSISTVDSMIALDIDPLENTDFRVLELYSQKELRSSNVFDLEEIMREFNSYKQRVKYVEDK 701 VVDPLPPYLKGLDDLMSGLGAAGKAVGVAIGAVGGAVASVVEGVATFLKNPFGAFTIILVAIAVVIITYLIYTRQRRLCTQPLQNLFPYLVSADGTTVTS 801 GSTKDTSLQAPPSYEESVYNSGRKGPGPPSSDASTAAPPYTNEQAYQMLLALARLDAEQRAQQNGTDSLDGRTGTQDKGQKPNLLDRLRHRKNGYRHLKD PSYEESVYNSGRKGP 17.132 (819) 901 SDEEENV 850/2881) score = 134.797 18.833 (total and max score) >gi|52139228|ref|YP_081501.1| tegument protein UL43 [Human herpesvirus 5] 1 MEKTPAETTAVSAGNVPRDSIPCITNVSADTRGRTRPSRPATVPQRRPARIGHFRRRSASLSFLDWPDDSVTEGVRTTSASVAASAARFDEIRRRRQSIN HFRRRSASLSFLDWP 18.833 (60) EIRRRRQSINDEMKE 17.752 (98) HFRRRSASLSFLDWP 18.716 (60) EIRRRRQSINDEMKE 13.281 (98) IGHFRRRSASLSFLD 13.017 (58) EIRRRRQSINDEMKE 10.856 (98) IGHFRRRSASLSFLD 9.422 (58) HFRRRSASLSFLDWP 8.845 (60) 101 DEMKERTLEDALAVELVNETFRCSVTSDARKDLQKLVRRVSGTVLRLSWPNGWFFTYCDLLRVGYFGHLNIKGLEKTFLCCDKFLLPVGTVSRCEAIGRP 201 PLPVLIGEGGRVYVYSPVVESLYLVSRSGFRGFVQEGLRNYAPLREELGYVRFETGGDVGREFMLARDLLALWRLCMKREGSIFSWRDGNEALTTVVLNG VLNGSQTYEDPAHGN 15.805 (304) VLNGSQTYEDPAHGN 8.269 (304) 301 SQTYEDPAHGNWLKETCSLNVLQVFVVRAVPVESQQRLDISILVNESGAVFGVHPDTRQAHFLARGLLGFFRVGFLRFCNNYCFARDCFTHPESVAPAYR 401 ATGCPRELFCRRLRKKKGLFARR 851/2881) score = 134.797 18.833 (total and max score) >gi|28373239|ref|NP_783785.1| UL43 [Human herpesvirus 5 strain AD169] 1 MEKTPAETTAVSAGNVPRDSIPCITNVSADTRGRTRPSRPATVPQRRPARIGHFRRRSASLSFLDWPDGSVTEGVRTTSASVAASAARFDEIRRRRQSIN HFRRRSASLSFLDWP 18.833 (60) EIRRRRQSINDEMKE 17.752 (98) HFRRRSASLSFLDWP 18.716 (60) EIRRRRQSINDEMKE 13.281 (98) IGHFRRRSASLSFLD 13.017 (58) EIRRRRQSINDEMKE 10.856 (98) IGHFRRRSASLSFLD 9.422 (58) HFRRRSASLSFLDWP 8.845 (60) 101 DEMKERTLEDALAVELVNETFRCSVTSDARKDLQKLVRRVSGTVLRLSWPNGWFFTYCDLLRVGYFGHLNIKGLEKTFLCCDKFLLPVGTVSRCEAIGRP 201 PLPVLIGEGGRVYVYSPVVESLYLVSRSGFRGFVQEGLRNYAPLREELGYVRFETGGDVGREFMLARDLLALWRLCMKREGSIFSWRDGNEALTTVVLNG VLNGSQTYEDPAHGN 15.805 (304) VLNGSQTYEDPAHGN 8.269 (304) 301 SQTYEDPAHGNWLKETCSLNVLQVFVVRAVPVESQQRLDISILVNESGAVFGVHPETRQAHFLARGLLGFFRVGFLRFCNNYCFARDCFTHPESVAPAYR 401 ATGCPRELFCRRLRKKKGLFARR 854/2881) score = 93.845 18.829 (total and max score) >gi|52139245|ref|YP_081518.1| helicase-primase primase subunit [Human herpesvirus 5] 1 MTLVLFATEYDSAHIVANVLSQTPTDHCVFPLLVKHQVSRRVYFCLQTQKCSDSRRVAPVFAVNNETLQLSRYLAARQPIPLSALIASLDEAETRPLYRH 101 LFRTPVLSPEHGGEVREFKHLVYFHHAAVLRHLNQVFLCPTSPSWFISVFGHTEGQVLLTMAYYLFEGQYSTISTVEEYVRSFCTRDLGTIIPTHASMGE YYLFEGQYSTISTVE 11.569 (170) 201 FARLLLGSPFRQRVSAFVAYAVARNRRDYTELEQVDTQINAFRERARLPDTVCVHYVYLAYRTALARARLLEYRRVVAYDADAAPEAQCTREPGFLGRRL GFLGRRLSTELLDVM 14.248 (301) 301 STELLDVMQKYFSLDNFLHDYVETHLLRLDESPHSATSPHGLGLAGYGGRIDGTHLAGFFGTSTQLARQLERINTLSESVFSPLERSLSGLLRLCASLRT 401 AQTYTTGTLTRYSQRRYLLPEPALAPLLERPLPVYRVHLPNDQHVFCAVASETWHRSLFPRDLLRHVPDSRFSDEALTETVWLHDDDVASTSPETQFYYT HVPDSRFSDEALTET 12.714 (473) 501 RHEVFNERLPVFNFVADFDLRLRDGVSGLARHTVFELCRGLRRVWMTVWASLFGYTHPDRHPVYFFKSACPPNSVPVDAAGAPFDDDDYLDYRDERDTEE APFDDDDYLDYRDER 18.829 (589) DYRDERDTEEDEDGK 14.003 (598) DDDDYLDYRDERDTE 7.315 (592) 601 DEDGKEDKNNVPGNGVFQKTTSSVDTSPPYCRCKGKLGLRIITPFPACTIAVHPSVLRAVAQVLNHAVCLDAELHTLLDPISHPESSLDTGIYHHGRSVR 701 LPYMYKMDQDDGYFMHRRLLPLFIVPDAYREHPLGFVRAQLDLRNLLHHHPPHDLPALPLSPPPRVILSVRDKICPSTEANFIETRSLNVTRYRRRGLTE KMDQDDGYFMHRRLL 15.168 (713) 801 VLAYHLYGGDGATAAAISDTDLQRLVVTRVWPPLLEHLTQHYEPHVSEQFTAPHVLLFQPHGACCVAVKRRDGARTRDFRCLNYTHRNPQETVQVFIDLR 901 TEHSYALWASLWSRCFTKKCHSNAKNVHISIKIRPPDAPMPPATAV 855/2881) score = 93.845 18.829 (total and max score) >gi|28373251|ref|NP_783788.1| UL70 [Human herpesvirus 5 strain AD169] 1 MTLVLFATEYDSAHIVANVLSQTPTDHCVFPLLVKHQVSRRVYFCLQTQKCSDSRRVAPVFAVNNETLQLSRYLAARQPIPLSALIASLDEAETQPLYRH 101 LFRTPVLSPEHGGEVREFKHLVYFHHAAVLRHLNQVFLCPTSPSWFISVFGHTEGQVLLTMAYYLFEGQYSTISTVEEYVRSFCTRDLGTIIPTHASMGE YYLFEGQYSTISTVE 11.569 (170) 201 FARLLLGSPFRQRVSAFVAYAVARNRRDYTELEQVDTQINAFRERARLPDTVCVHYVYLAYRTALARARLLEYRRVVAYDADAAPEAQCTREPGFLGRRL GFLGRRLSTELLDVM 14.248 (301) 301 STELLDVMQKYFSLDNFLHDYVETHLLRLDESPHSATSPHGLGLAGYGGRIDGTHLAGFFGTSTQLARQLERINTLSESVFSPLERSLSGLLRLCASLRT 401 AQTYTTGTLTRYSQRRYLLPEPALAPLLERPLPVYRVHLPNDQHVFCAVASETWHRSLFPRDLLRHVPDSRFSDEALTETVWLHDDDVASTSPETQFYYT HVPDSRFSDEALTET 12.714 (473) 501 RHEVFNERLPVFNFVADFDLRLRDGVSGLARHTVFELCRGLRRVWMTVWASLFGYTHPDRHPVYFFKSACPPNSVPVDAAGAPFDDDDYLDYRDERDTEE APFDDDDYLDYRDER 18.829 (589) DYRDERDTEEDEDGK 14.003 (598) DDDDYLDYRDERDTE 7.315 (592) 601 DEDGKEDKNNVPDNGVFQKTTSSVDTSPPYCRCKGKLGLRIITPFPACTVAVHPSVLRAVAQVLNHAVCLDAELHTLLDPISHPESSLDTGIYHHGRSVR 701 LPYMYKMDQDDGYFMHRRLLPLFIVPDAYREHPLGFVRAQLDLRNLLHHHPPHDLPALPLSPPPRVILSVRDKICPSTEANFIETRSLNVTRYRRRGLTE KMDQDDGYFMHRRLL 15.168 (713) 801 VLAYHLYGGDGATAAAISDTDLQRLVVTRVWPPLLEHLTQHYEPHVSEQFTAPHVLLFQPHGACCVAVKRRDGARTRDFRCLNYTHRNPQETVQVFIDLR 901 TEHSYALWASLWSRCFTKKCHSNAKNVHISIKIRPPDAPVPPATAV 865/2881) score = 45.412 18.758 (total and max score) >gi|52139238|ref|YP_081512.1| nuclear egress lamina protein [Human herpesvirus 5] 1 MSSVSGVRTPRERRSALRSLLRKRRQRELASKVASTVNGATSANNHGEPPSPADARPRLTLHDLHDIFREHPELELKYLNMMKMAITGKESICLPFNFHS RTPRERRSALRSLLR 18.758 (15) NNHGEPPSPADARPR 7.688 (51) SSVSGVRTPRERRSA 12.569 (9) 101 HRQHTCLDISPYGNEQVSRIACTSCEDNRILPTASDAMVAFINQTSNIMKNRNFYYGFCKSSELLKLSTNQPPIFQIYYLLHAANHDIVPFMHAENGRLH 201 MHVIFENSDVHIPCDCITQMLTAAREDYSVTLNIVRDHVVISVLCHAVSASSVKIDVTILQRKIDEMDIPNDVSESFERYKELIQELCQSSGNNLYEEAT 301 SSYAIRSPLTASPLHVVSTNGCGPSSSSQSTPPHLHPPSQATQPHHYSHHQSQSQQHHHRPQSPPPPLFLNSIRAP PSSSSQSTPPHLHPP 6.397 (331) 866/2881) score = 45.412 18.758 (total and max score) >gi|9625738|ref|NP_039987.1| UL53 [Human herpesvirus 5 strain AD169] 1 MSSVSGVRTPRERRSALRSLLRKRRQRELASKVASTVNGATSANNHGEPPSPADARPRLTLHDLHDIFREHPELELKYLNMMKMAITGKESICLPFNFHS RTPRERRSALRSLLR 18.758 (15) NNHGEPPSPADARPR 7.688 (51) SSVSGVRTPRERRSA 12.569 (9) 101 HRQHTCLDISPYGNEQVSRIACTSCEDNRILPTASDAMVAFINQTSNIMKNRNFYYGFCKSSELLKLSTNQPPIFQIYYLLHAANHDIVPFMHAEDGRLH 201 MHVIFENPDVHIPCDCITQMLTAAREDYSVTLNIVRDHVVISVLCHAVSASSVKIDVTILQRKIDEMDIPNDVSESFERYKELIQELCQSSGNNLYEEAT 301 SSYAIRSPLTASPLHVVSTNGCGPSSSSQSTPPHLHPPSQATQPHHYSHHQSQSQQHHHRPQSPPPPLFLNSIRAP PSSSSQSTPPHLHPP 6.397 (331) 871/2881) score = 43.366 18.708 (total and max score) >gi|9625681|ref|NP_039930.1| RL10 [Human herpesvirus 5 strain AD169] 1 MYPRVMHAVCFLALSLVSYVAVCAETKVATNCLVKSEDTHLTCKCSPNNTSSNTGNGSKCHAMCKCRITEPITMLGAYSAWGAGSFVATLIVLLVVFFVI 101 YAREEEKNNTGTEVDQCLAYRSLTRKKLEQHAAKKQNIYERIPYRPSRQKDNSPLIEPTGTDDEEDEDDNV PSRQKDNSPLIEPTG 18.708 (153) AAKKQNIYERIPYRP 14.604 (139) PLIEPTGTDDEEDED 10.054 (161) 872/2881) score = 43.366 18.708 (total and max score) >gi|9625825|ref|NP_040074.1| RL10 [Human herpesvirus 5 strain AD169] 1 MYPRVMHAVCFLALSLVSYVAVCAETKVATNCLVKSENTHLTCKCSPNNTSSNTGNGSKCHAMCKCRITEPITMLGAYSAWGAGSFVATLIVLLVVFFVI 101 YAREEEKNNTGTEVDQCLAYRSLTRKKLEQHAAKKQNIYERIPYRPSRQKDNSPLIEPTGTDDEEDEDDNV PSRQKDNSPLIEPTG 18.708 (153) AAKKQNIYERIPYRP 14.604 (139) PLIEPTGTDDEEDED 10.054 (161) 875/2881) score = 89.704 18.691 (total and max score) >gi|52139313|ref|YP_081588.1| protein US1 [Human herpesvirus 5] 1 MASGLGDLSVGVSSLPMRELAWRRVADDSHDLWCCCMDWKAHVEYAHPASELRPGSGGWPEHAEAQWRQQVHAAHDVWCNCGDWQGHALRSRSRTAESGR RTAESGRSSSSSSVS 14.835 (101) RTAESGRSSSSSSVS 13.711 (101) ESGRSSSSSSVSVLS 12.292 (104) GRSSSSSSVSVLSDG 10.866 (106) AESGRSSSSSSVSVL 6.816 (103) ALRSRSRTAESGRSS 6.592 (95) TAESGRSSSSSSVSV 5.901 (102) 101 SSSSSSVSVLSDGDQQPWWRRLRVKRPKFPSWARRWTQRHDSEERASQQAKNDSTS HDSEERASQQAKNDS 18.691 (147) 883/2881) score = 52.732 18.491 (total and max score) >gi|9625873|ref|NP_040122.1| TRS1 [Human herpesvirus 5 strain AD169] 1 MAQRNGMSPRPPPLGRGRGAGGPSGVGSSPPSSCVPMGAPSTAGTGASAAATTTPGHGVHRVEPRGPPGAPPSSGNNSNFWHGPERLLLSQIPVERQALT 101 ELEYQAMGAVWRAAFLANSTGRAMRKWSQRDAGTLLPLGRPYGFYARVTPRSQMNGVGATDLRQLSPRDAWIVLVATVVHEVDPAADPTLGDKAGHPEGL 201 CAQDGLYLALGAGFRVFVYDLANNTLILAARDADEWFRHGAGEVVRLYRCNRLGVGTPRATLLPQPALRQTLLRAEEATALGRELRRRWAGTTVALQTPG 301 RRLQPMVLLGAWQELAQYEPFASAPHPASLLTAVRRHLNQRLCCGWLALGAVLPARWLGCAAGPATGTAAGTTSPPAASGTETEAAGGDAPCAIAGAVGS GTAAGTTSPPAASGT 18.491 (374) 401 AVPVPPQPYGAAGGGAICVPNADAHAVVGADAAAAAAPTVMVGSTAMAGPAASGTVPRAMLVVLLDELGAVFGYCPLDGHVYPLAAELSHFLRAGVLGAL 501 ALGRESAPAAEAARRLLPELDREQWERPRWDALHLHPRAALWAREPHGQLAFLLRPGRGEAEVLTLATKHPAICANVEDYLQDARRRADAQALGLDLATV 601 VMEAGGQMIHKKTKKPKGKEDESLMKGKHSRYTRPTEPPLTPQASLGRALRRDDEDWKPSRLPGEDSWYDLDETFWVLGSNRKNDVYQRRWKKTVLRCGL RPTEPPLTPQASLGR 15.312 (641) RPTEPPLTPQASLGR 2.983 (641) 701 EIDRPMPTVPKGCRPQTFTHEGIQLMGGATQEPLDTGLYAPSHVTSAFVPSVYMPPTVPYPDPAARLCRDMRRVTFSNIATHYHYNAQ CRDMRRVTFSNIATH 15.947 (775) 892/2881) score = 63.928 18.433 (total and max score) >gi|9625741|ref|NP_039990.1| UL56 [Human herpesvirus 5 strain AD169] 1 MEMNLLQKLCVVCSKCNEYAMELECLKYCDPNVLLAESTPFKRNAAAIVYLYRKIYPEVVAQNRTQSSLLTLYLEMLLKALHEDTALLDRALMAYSRQPD NVLLAESTPFKRNAA 4.766 (39) 101 RAAFYRTVLRLDRCDRHHTVELQFTDNVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGTTCAQCYEELTI 201 IPNQGRSLNKRLQGLLCNHIAVHRPSSQSDVNIQTVEQDLLDLTTRIPHLAGVLSALKSLFSSSSAYHSYIQEAEEALREYNLFTDIPERIYSLSDFTYW IAVHRPSSQSDVNIQ 12.446 (227) 301 SRTSEVIVKRVGITIQQLNVYHQLCRALMNGISRHLYGEDVEDIFVLGEKALDGEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKLHESNEMYTK 401 IKHILEEIRRPLPDGTGGDGPEGEAIHLRGREAMSGTGTTLMTASNSSNSSTHSQRNNGGGGRARGGGKKVVGGGVNGQDGDGSENGLRVRNCDEHEALD 501 LVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQDVVDVGDQFTYDEHLYVVNNL QKVSEVGYGKVIRCI 13.633 (531) 601 IHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEGTVYPSEWMVVKYMGFFNFSDCQDLNVLQKEMWMHVR 701 ELVLSVALYNETFGKQLSIACLRDELHPDRDVILTYNKEWPLLLRHEGSLYKSKDLYLLLYRHLSRPDESGDVPTAPVAKPSTLTAAAAVSGVFREPDRP LLLYRHLSRPDESGD 14.651 (765) PDRPWLPSPYPSSST 18.433 (804) 801 WLPSPYPSSSTAGVSRRVRATRKRPRRASSLLDLARDEHGIQDLVPGSLR 893/2881) score = 63.928 18.433 (total and max score) >gi|52139242|ref|YP_081515.1| DNA packaging terminase subunit 2 [Human herpesvirus 5] 1 MEMNLLQKLCVVCSKCNEYAMELECLKYCDPNVLLAESTPFKRNAAAIVYLYRKIYPEVVAQNRTQSSLLTLYLEMLLKALHEDTALLDRALMAYSRQPD NVLLAESTPFKRNAA 4.766 (39) 101 RAAFYRTVLRLDRCDRHHTVELQFTDNVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGTTCAQCYEELTI 201 IPNQGRSLNKRLQGLLCNHIAVHRPSSQSDVNIQTVEQDLLDLTTRIPHLAGVLSALKSLFSSSSAYHSYIQEAEEALREYNLFTDIPERIYSLSDFTYW IAVHRPSSQSDVNIQ 12.446 (227) 301 SRTSEVIVKRVGITIQQLNVYHQLCRALMNGISRHLYGEDVEDIFVLGEKALDGEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKLHESNEMYTK 401 IKHILEEIRRPLPDGTGGDGPEGEVIHLRGREAMSGTGTTLMTASNSSNSSTHSQRNNGGGGRARGGGKKAVGGGANGQDGDGSENGLRVRNCDEHEALD 501 LVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQDVVDVGNQFTYDEHLYVVNNL QKVSEVGYGKVIRCI 13.633 (531) 601 IHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEGTVYPSEWMVVKYMGFFNFSDCQDLNVLQKEMWMHVR 701 ELVLSVALYNETFGKQLSIACLRDELHPDRDVILTYNKEWPLLLRHEGSLYKSKDLYLLLYRHLSRPDESGDVPTAPVAKPSTLTAAAAVSGAFREPDRP LLLYRHLSRPDESGD 14.651 (765) PDRPWLPSPYPSSST 18.433 (804) 801 WLPSPYPSSSTAGVSRRVRATRKRPRRASSLLDLARDEHGIQDLVPGSLR 895/2881) score = 87.523 18.429 (total and max score) >gi|52139332|ref|YP_081607.1| tegument protein US22 [Human herpesvirus 5] 1 MSLLTKAAAEAWGTYLRQRDERCEDAIRCDYGVFQFRNTVFQKTLSMLQGLYLRQYDPPALRTYVQRHQGTTVALRNPANWFLVMREQAAIPQIYARSLA QGLYLRQYDPPALRT -2.353 (56) 101 ADYLCCDDTLEAVGVLAVRPPDSDLTRNTKQAQELPCVLMLSHYGTVYVYDWETDGLYEVASDIKAFSKNGLLWCEYVYRHPQTPFATTEPRYHVQKFLC DWETDGLYEVASDIK 14.923 (158) 201 TDPTDAAAVAKTAREMNGLNLVIRTPGRTEVEPLLMLGSIEGLRACRPFDHMPAADFRDLLNFIRQRLCCEWYVVGLVGYYLAYGPFVPSGMVLLDKFGV 301 VYLHKIEDSDLYRIADNFHMFLKCGLLKLRGLCRFDRGLRGECRLEELPVCHHTLKRDVLRWHGALGTITRSQLESALDWFLRPTRGTDKVPNNSSAWGR 401 TDLLPTGALQDNQNWAFPSHSVETLPALQGGLWEDNDETTQTVDGQRCFRMPKFFPPPMCRAPYNECGVELPGGDSSDEDESGRPRRIANRIGDTPETPC VELPGGDSSDEDESG 14.621 (476) ELPGGDSSDEDESGR 13.360 (477) ELPGGDSSDEDESGR 9.719 (477) ELPGGDSSDEDESGR 9.203 (477) RIGDTPETPCNSENE 4.677 (498) TPETPCNSENEDDTT 2.637 (502) VELPGGDSSDEDESG 2.307 (476) 501 NSENEDDTTVEGTSGGPEAMDSQAPYPSEDSPTTEKEAWLQRGRRAKAMHARGHTLKQVPIPEPDQMGDDGPDPGP GGPEAMDSQAPYPSE 18.429 (522) 896/2881) score = 87.523 18.429 (total and max score) >gi|28373241|ref|NP_783806.1| US22 [Human herpesvirus 5 strain AD169] 1 MSLLTKAAAEAWGTYLRQRDERCEDAIRCDYGVFQFRNTVFQKTLSMLQGLYLRQYDPPALRTYVQRHQGTTVALRNPANWFLVMREQAAIPQIYARSLA QGLYLRQYDPPALRT -2.353 (56) 101 ADYLCCDDTLEAVGVLAVRPPDSDLTRNTKQAQELPCVLMLSHYGTVYVYDWETDGLYEVASDIKAFSKNGLLWCEYVYRHPQTPFATTEPRYHVQKFLC DWETDGLYEVASDIK 14.923 (158) 201 TDPTDAAAVAKTAREMSGLNLVIRTPGRTEVEPLLMLGSIEGLRACRPFDHMPAADFRDLLNFIRQRLCCEWYVVGLVGYYLAYGPFVPSGLVLLDKFGV 301 VYLHKIEDSDLYRIADNFHMFLKCGLLKLRGLCRFDRGLRGECRLEELPVCHHTLKRDVLRWHGALGTITRSQLESALDWFLRPTRGTDKVPNNSSAWGR 401 TDLLPTGALQDNQNWAFPSHSVETLPALQGGLWEDNDETTQTVDGQRCFRMPKFFPPPMCRVPYNECGVELPGGDSSDEDESGRPRRIANRIGDTPETPC VELPGGDSSDEDESG 14.621 (476) ELPGGDSSDEDESGR 13.360 (477) ELPGGDSSDEDESGR 9.719 (477) ELPGGDSSDEDESGR 9.203 (477) RIGDTPETPCNSENE 4.677 (498) TPETPCNSENEDDTT 2.637 (502) VELPGGDSSDEDESG 2.307 (476) 501 NSENEDDTTVEGTSGGPEAMDSQAPYPSEDSPTTEKEAWLQRGRRAKAMHARGHTLKQVPIPEPDQMGDDGPDPGP GGPEAMDSQAPYPSE 18.429 (522) 900/2881) score = 58.907 18.380 (total and max score) >gi|9625762|ref|NP_040011.1| UL77 [Human herpesvirus 5 strain AD169] 1 MSLLHTFWRLPVAVFFEPHEENVLRCPERVLRRLLEDAAVTMRGGGWREDVLMDRVRKRYLRQELRDLGHRVQTYCEDLEGRVSEAEALLNQQCELDEGP 101 SPRTLLQPPCRPRSSSPGTGVAGASAVPHGLYSRHDAITGPAAAPSDVVAPSDAVAASAAAGASSTWLAQCAERPLPGNVPSYFGITQNDPFIRFHTDFR PCRPRSSSPGTGVAG 9.283 (116) PCRPRSSSPGTGVAG 4.422 (116) 201 GEVVNTMFENASTWTFSFGIWYYRLKRGLYTQPRWKRVYHLAQMDNFSISQELLLGVVNALENVTVYPTYDCVLSDLEAAACLLAAYGHALWEGRDPPDS QMDNFSISQELLLGV 6.196 (250) 301 VATVLGELPQLLPRLADDVSREIAAWEGPVAAGNNYYAYRDSPDLRYYMPLSGGRHYHPGTFDRHVLVRLFHKRGVIQHLPGYGTITEELVQERLSGQVR 401 DDVLSLWSRRLLVGKLGRDVPVFVHEQQYLRSGLTCLAGLLLLWKVTNADSVFAPRTGKFTLADLLGSDAVAGGGLPGGRAGGEEEGYGGRHGRVRNFEF AGGEEEGYGGRHGRV 18.380 (488) 501 LVRYYIGPWYARDPAVTLSQLFPGLALLAVTESVRSGWDPSRREDSAGGGDGGGAVLMQLSKSNPVADYMFAQSSKQYGDLRRLEVHDALLFHYEHGLGR KSNPVADYMFAQSSK 9.846 (569) 601 LLSVTLPRHRVSTLGSSLFNVNDIYELLYFLVLGFLPSVAVL NDIYELLYFLVLGFL 10.779 (629) 904/2881) score = 84.284 18.363 (total and max score) >gi|9625783|ref|NP_040032.1| UL97 [Human herpesvirus 5 strain AD169] 1 MSSALRSRARSASLGTTTQGWDPPPLRRPSRARRRQWMREAAQAAAQAAVQAAQAAAAQVAQAHVDENEVVDLMADEAGGGVTTLTTLSSVSTTTVLGHA RSRARSASLGTTTQG 3.119 (13) 101 TFSACVRSDVMRDGEKEDAASDKENLRRPVVPSTSSRGSAASGDGYHGLRCRETSAMWSFEYDRDGDVTSVRRALFTGGSDPSDSVSGVRGGRKRPLRPP RPVVPSTSSRGSAAS 14.003 (135) GEKEDAASDKENLRR 9.502 (121) RETSAMWSFEYDRDG 2.202 (159) SAASGDGYHGLRCRE 7.688 (146) 201 LVSLARTPLCRRRVGGVDAVLEENDVELRAESQDSAVASGPGRIPQPLSGSSGEESATAVEADSTSHDDVHCTCSNDQIITTSIRGLTCDPRMFLRLTHP GRIPQPLSGSSGEES 18.363 (249) IPQPLSGSSGEESAT 12.813 (251) GRIPQPLSGSSGEES 6.142 (249) DVELRAESQDSAVAS 5.445 (232) PQPLSGSSGEESATA 5.007 (252) 301 ELCELSISYLLVYVPKEDDFCHKICYAVDMSDESYRLGQGSFGEVWPLDRYRVVKVARKHSETVLTVWMSGLIRTRAAGEQQQPPSLVGTGVHRGLLTAT 401 GCCLLHNVTVHRRFHTDMFHHDQWKLACIDSYRRAFCTLADAIKFLNHQCRVCHFDITPMNVLIDVNPHNPSEIVRAALCDYSLSEPYPDYNERCVAVFQ 501 ETGTARRIPNCSHRLRECYHPAFRPMPLQKLLICDPHARFPVAGLRRYCMSELSALGNVLGFCLMRLLDRRGLDEVRMGTEALLFKHAGAACRALENGKL 601 THCSDACLLILAAQMSYGACLLGEHGAALVSHTLRFVEAKMSSCRVRAFRRFYHECSQTMLHEYVRKNVERLLATSDGLYLYNAFRRTTSIICEEDLDGD 701 CRQLFPE 907/2881) score = 63.850 18.329 (total and max score) >gi|28373240|ref|NP_783791.1| UL102 [Human herpesvirus 5 strain AD169] 1 MTAQPPLHHRHHPYTLFGTSCHLSWYGLLEASVPIVQCLFLDLGGGRAEPRLHTFVVRGDRLPPAEVRAVHRASYAALASAVTTDADERRRGLEQRSAVL 101 ARVLLEGSALIRVLARTFTPVQIQTDASGVEILEAAPALGVETAALSNALSLFHVAKLVVIGSYPEVHEPRVVTHTAERVSEEYGTHAHKKLRRGYYAYD KKLRRGYYAYDLAMS 7.024 (197) 201 LAMSFRVGTHKYVLERDDEAVLARLFEVREVCFLRTCLRLVTPVGFVAVAVTDEQCCLLLQSAWTHLYDVLFRGFAGQPPLRDYLGPDLFETGAARSFFF 301 PGFPPVPVYAVHGLHTLMRETALDAAAEVLSWCGLPDIVGSAGKLEVEPCALSLGVPEDEWQVFGTEAGGGAVRLNATAFRERPAGGDRRWLLPPLPRDD 401 GDGENNVVEVSSSTGGAHPPSDDATFTVHVRDATLHRVLIVDLVERVLAKCVRARDFNPYVRYSHRLHTYAVCEKFIENLRFRSRRAFWQIQSLLGYISE RARDFNPYVRYSHRL 9.328 (460) 501 HVTSACASAGLLWVLSRGHREFYVYDGYSGHGPVSAEVCVRTVVDCYWRKLFGGDDPGPTCRVQESAPGVLLVWGDERLVGPFNFFYGNGGAGGSPLHGV 601 VGGFAAGHCGGACCAGCVVTHRHSSGGGGSGVGDADHASGGGLDAAAGSGHNGGSDRVSPSTPPAALGGCCCAAGGDWLSAVGHVLGRLPALLRERVSVS SDRVSPSTPPAALGG 3.955 (662) ALLRERVSVSELEAV 18.329 (698) SDRVSPSTPPAALGG 3.168 (662) VSELEAVYREILFRF 6.719 (706) 701 ELEAVYREILFRFVARRNDVDFWLLRFQPGENEVRPHAGVIDCAPFHGVWAEQGQIIVQSRDTALAADIGYGVYVDKAFAMLTACVEVWARELLSSSTAS 801 TTACSSSSVLSSALPSVTSSSSGTATVSPPSCSSSSATWLEERDEWVRSLAVDAQHAAKRVASEGLRFFRLNA SSGTATVSPPSCSSS 15.327 (828) 908/2881) score = 63.850 18.329 (total and max score) >gi|52139273|ref|YP_081548.1| helicase-primase subunit [Human herpesvirus 5] 1 MTAQPPLHHRHHPYTLFGTSCHLSWYGLLEASVPIVQCLFLDLGGGRAEPRLHTFVVRGDRLPPAEVRAVHRASYAALASAVTTDADERRRGLEQRSAVL 101 ARVLLEGSALIRVLARTFTPVQIQTDASGVEILEAAPALGVETTALSNALSLFHVAKLVVIGSYPEVHEPRVVTHAAERVSEEYGTHAHKKLRRGYYAYD KKLRRGYYAYDLAMS 7.024 (197) 201 LAMSFRVGTHKYVLERDDEAVLARLFEVREVCFLRTCLRLVTPVGFVAVAVTDEQCCLLLQSAWTHLYDVLFRGFAGQPPLRDYLGPDLFETGAARSFFF 301 PGFPPVPVYAVHGLHTLMRETALDAAAEVLSWCGLPDIVGSAGKLEVEPCALSLGVPEDEWQVFGTEAGGGAVRLNATAFRERPAGGDRRWLLPPLPRDD 401 GDGENNVVEVSSSTGGAHPPSDDATFTVHVRDATLHRVLIVDLVERVLAKCVRARDFNPYVRYSHRLHTYAVCEKFIENLRFRSRRAFWQIQSLLGYISE RARDFNPYVRYSHRL 9.328 (460) 501 HVTSACASAGLLWVLSRGHREFYVYDGYSGHGPVSAEVCVRTVVDCYWRKLFGGDDPGPTCRVQESAPGVLLVWGDERLVGPFNFFYGNGGAGGSPLHGV 601 VGGFAAGHCGGACCAGCVVTHRHSSGGGGSGVGDADHASGGGLDAAAGSGHNGGSDRVSPSTPPAALGGCCCAAGGDWLSAVGHVLGRLPALLRERVSVS SDRVSPSTPPAALGG 3.955 (662) ALLRERVSVSELEAV 18.329 (698) SDRVSPSTPPAALGG 3.168 (662) VSELEAVYREILFRF 6.719 (706) 701 ELEAVYREILFRFVARRNDVDFWLLRFQPGENEVRPHAGVIDCAPFHGVWAEQGQIIVQSRDTALAADIGYGVYVDKAFAMLTACVEVWARELLSSSTAS 801 TTTCSSSSVLSSALPSVTSSSSGTATVSPPSCSSSSATWLEERDEWVRSLAVDAQHAAKRVASEGLRFFRLNA SSGTATVSPPSCSSS 15.327 (828) 917/2881) score = 44.041 18.264 (total and max score) >gi|52139266|ref|YP_081541.1| tegument protein UL16 [Human herpesvirus 5] 1 MAWRSGLCETDSRTLKQFLQEECMWKLVGKSRKHREYRAVACRSTIFSPEDDGSCILCQLLLFYRDGEWILCLCCNGRYQGHYGVGHVHRRRRRICHLPT YRAVACRSTIFSPED 18.264 (44) NGRYQGHYGVGHVHR 9.980 (83) 101 LYQLSFGGPLGPASIDFLPSFSQVTSSMTCDGITPDVIYEVCMLVPQDEAKRILVKGHGAMDLTCQKAVTLGGAGAWLLPRPEGYTLFFYILCYDLFTSC 201 GNRCDIPSMTRLMAAATACGQAGCSFCTDHEGHVDPTGNYVGCTPDMGRCLCYVPCGPMTQSLIHNEEPATFFCESDDAKYLCAVGSKTAAQVTLGDGLD HVDPTGNYVGCTPDM 13.213 (240) QAGCSFCTDHEGHVD 2.583 (228) 301 YHIGVKDSEGRWLPVKTDVWDLVKVEEPVSRMIVCSCPVLKNLVH 918/2881) score = 42.505 18.264 (total and max score) >gi|9625780|ref|NP_040029.1| UL94 [Human herpesvirus 5 strain AD169] 1 MAWRSGLCETDSRTLKQFLQEECMWKLVGKSRKHREYRAVACRSTIFSPEDDSSCILCQLLLLYRDGEWIICFCCNGRYQGHYGVNHVHRRRRRICHLPT YRAVACRSTIFSPED 18.264 (44) NGRYQGHYGVNHVHR 8.445 (83) 101 LYQLSFGGPLGPASIDFLPSFSQVTSSMTCDGITPDVIYEVCMLVPQDEAKRILVKGHGAMDLTCQKAVTLGGAGAWLLPRPEGYTLFFYILCYDLFTSC 201 GNRCDIPSMTRLMAAATACGQAGCSFCTDHEGHVDPTGNYVGCTPDMGRCLCYVPCGPMTQSLIHNEEPATFFCESDDAKYLCAVGSKTAAQVTLGDGLD HVDPTGNYVGCTPDM 13.213 (240) QAGCSFCTDHEGHVD 2.583 (228) 301 YHIGVKDSEGRWLPVKTDVWDLVKVEEPVSRMIVCSCPVLKNLVH 978/2881) score = 41.361 17.865 (total and max score) >gi|28373217|ref|NP_783772.1| UL10 [Human herpesvirus 5 strain AD169] 1 MRRLINHIVNHDLFRWSVMTAMIFYRYSETCMEVTVRVGDPVTLGSGHGYHPGQKVHWYNQSCVGISNGENTHPICTYDPPKPGRRKTMKTTPLPSPLLY PKPGRRKTMKTTPLP 15.669 (88) NTHPICTYDPPKPGR 2.558 (78) 101 ECHNSTLSILHVNVSDPKNYCRRKCPPNGNCEFPTCFTLSLISRTTTTRKPGQKTTLSRLKTTPNKHTQHKRSTRRTSPRDYNVTGLPKGFADSFTGNVE KRSTRRTSPRDYNVT 17.865 (178) KRSTRRTSPRDYNVT 5.269 (178) 201 AHRAKDAAHSAWILIVIIIIIVVILFFFKIPQRLREKWDTRGYLYKGTDGLPTTDYLS 1000/2881) score = 51.627 17.710 (total and max score) >gi|52139344|ref|YP_081619.1| tegument protein TRS1 [Human herpesvirus 5] 1 MAQRNGMSPRPPPLGRGRGAGGPSGVGSSPPSSCVPMGATSTAGTGASAAPTATPGHGVHRVEPRGPPGAPPSSGNNSNFWHGPERLLLSQIPVERQALT 101 ELEYQAMGAVWRAAFLANSTGRAMRKWSQRDAGTLLPLGRPYGFYARVTPRSQMNGVGATDLRQLSPRDAWIVLVATVVHEVDPAADPTVGDKAGHPEGL 201 CAQDGLYLALGAGFRVFVYDLANNTLILAARDADEWFRHGAGEVVRLYRCNRLGVGTPRATLLPQPALRQTLLRAEEATALGRELRRRWAGTTVALQTPG 301 RRLQPMVLLGAWQELAQYEPFASAPHPASLLTAVRRHLNQRLCCGWLALGAVLPARWLGCAAGPATGTTSPPAASGTETEAAGGDAPCAMAGAVGSAVTI GPATGTTSPPAASGT 17.710 (370) 401 PPQPYGGAGGSAICVPNADAHAVVGADATAAAAAAAAAPTVMVGPTAMAGPAASGTVPRAMLVVVLDELGAVFGYCPLDGHVYPLAAELSHFLRAGVLGA 501 LALGRESAPAAEAARRLLPELDREQWERPRWDALHLHPRAALWAREPHGQLAFLLRPGRGEAEVLTLATKHPVICANVEDYLQDARRRADAQALGLDLAT 601 VVMEAGGQMIHKKTKKPKGKEDESVMKGKHSRYTRPTEPPLTPQASLGRALRRDDEDWKPSRVPGEDSWYDLDETFWVLGSNRKNDVYQRRWKKTVLRCG RPTEPPLTPQASLGR 15.312 (642) RPTEPPLTPQASLGR 2.983 (642) 701 LEIDRPMPTVPKGCRPQTFTHEGIQLMGGATQEPLDTGLYAPSHVTSAFVPSVYMPPTVPYPDPAARLCRDMRRVTFSNVATHYHYNA CRDMRRVTFSNVATH 15.622 (776) 1010/2881) score = 17.661 17.661 (total and max score) >gi|28373225|ref|NP_783782.1| UL34 [Human herpesvirus 5 strain AD169] 1 MNFIITTRDFSNDDSVLRAAEMRDNVAGSISKAYKGTVRAEGKKKLLLKHLPVPPGGCSRRNSNLFVFCTERDYRKFHQGIAQLKRAPAELDPHEIQQVT 101 ASIRCRLQPSLREPPTPADELQTAVSRVCALFNQLVFTAQLRHYCEHQDKVVSYARDELTKRCGEKSALGVEVHQLVALLPHERHRELCHVLIGLLHQTP 201 HMWARSIRLIGHLRHYLQNSFLHLLMNSGLDIAQVFDGCYHSEAYRMLFQIGHTDSVSAALELSHGAAAGPPEADENNDEGEEDDDELRHSDPAPLHESK 301 KPRNARRPRTRVPPHEQKPEENEEEEEELFPSCKATAAFLRAEPSVSNDDGNGGERCDTLATALRHRADEEDGPLASQTAVRVAATPSPSVTPALTPVTS PSVTPALTPVTSPIT 17.661 (396) 401 PITPLCI 1014/2881) score = 50.725 17.647 (total and max score) >gi|9625737|ref|NP_039986.1| UL52 [Human herpesvirus 5 strain AD169] 1 MNPSTHVSSNGPTTPPHGPHTTFLPPTSPAPSTSSVAAATLCSPQRQAVSRYSGWSTEYTQWHSDLTTELLWHAHPRQVPMDEALAAAAAASYQVNPQHP TTFLPPTSPAPSTSS 17.647 (28) TTFLPPTSPAPSTSS 4.537 (28) VSSNGPTTPPHGPHT 4.505 (14) VSSNGPTTPPHGPHT 3.215 (14) 101 ANRYRHYEFQTLSLGTSEVDELLNCCAEETTCGGTQSTVLTNATNTTSCGGAVAGSSNVGPAGASAACDLDAELAGLETSAADFEQLRRLCAPLAIDTRC 201 NLCAIISICLKQDCDQSWLLEYSLLCFKCSYAPRAALSTLIIMSEFTHLLQQHFSDLRIDDLFRHHVLTVFDFHLHFFINRCFEKQVGDAVDNENVTLNH 301 LAVVRAMVMGEDTVPYNKPRRHPQQKQKNNPYHVEVPQELIDNFLEHSSPSRDRFVQLLFYMWAGTGVMSTTPLTELTHTKFARLDALSTASEREDARMM FARLDALSTASERED 9.390 (389) 401 IEEEEDEEGGEKGGDDPGRHNGGGTSGGFSESTLKKNVGPIYLCPVPAFFTKNQTSTVCLLCELMACSYYDNVVLRELYRRVVSYCQNNVKMVDRIQLVL 501 ADLLRECTSPLGAAHEDVARCGLEAPTSPGGDSDYHGLSGVDGALARPDPVFCHVLRQAGVTGIYKHFFCDPQCAGNIRVTNEAVLFGRLHPHHVQEVKL SPGGDSDYHGLSGVD 11.430 (535) 601 AICHDNYYISRLPRRVWLCITLFKAFQITKRTYKGKVHLADFMRDFTQLLESCDIKLVDPTYVIDKYV 1015/2881) score = 50.725 17.647 (total and max score) >gi|52139239|ref|YP_081511.1| DNA packaging protein UL32 [Human herpesvirus 5] 1 MNPSTHVSSNGPTTPPHGPHTTFLPPTSPAPSTSSVAAATLCSPQRQAVSRYSGWSTEYTQWHSDLTTELLWHAHPRQVPMDEALAAAAAASYQVNPQHP TTFLPPTSPAPSTSS 17.647 (28) TTFLPPTSPAPSTSS 4.537 (28) VSSNGPTTPPHGPHT 4.505 (14) VSSNGPTTPPHGPHT 3.215 (14) 101 ANRYRHYEFQTLSLGTSEVDELLNCCAEETTCGGTQSTVLTNATNTTSCGGAVAGSSNAGPAGASAACDLDAELAGLETSAADFEQLRRLCAPLAIDTRC 201 NLCAIISICLKQDCDQSWLLEYSLLCFKCSYAPRAALSTLIIMSEFTHLLQQHFSDLRIDDLFRHHVLTVFDFHLHFFINRCFEKQVGDAVDNENVTLNH 301 LAVVRAMVMGEDTVPYNKPRRHPQQKQKNNPYHVEVPQELIDNFLEHSSPSRDRFVQLLFYMWAGTGVMSTTPLTELTHTKFARLDALSTASEREDARMM FARLDALSTASERED 9.390 (389) 401 MEEEEDEEGGEKGGDDPGRHNGGGTSGGFSESTLKKNVGPIYLCPVPAFFTKNQTSTVCLLCELMACSYYDNVVLRELYRRVVSYCQNNVKMVDRIQLVL 501 ADLLRECTSPLGAAHEDVARCGLEAPTSPGGDSDYHGLSGVDGALARPDPVFCHVLRQAGVTGIYKHFFCDPQCAGNIRVTNEAVLFGHLHPHHVQEVKL SPGGDSDYHGLSGVD 11.430 (535) 601 AICHDNYYISRLPRRVWLCITLFKAFQITKRTYKGKVHLADFMRDFTQLLENCDIKLVDPTYVIDKYV 1019/2881) score = 53.262 17.630 (total and max score) >gi|52139224|ref|YP_081497.1| protein UL38 [Human herpesvirus 5] 1 MTTTTHSTAAIMSLLDEAEWRQTQMDVGGLIQASALGKVALRYAVRKLMKRGARLRHDSGLYVCICDPSYEFLQMNLSKISWLERHCPPLDQELIMFGVI 101 EAWEEASVRPTRQLVLFMTPKWDVFAYDSGILFFLAPSMAQFWHGAIVLEYWNALFPVEVRSHVRQHAHTMDDLVMVFHQLDYEKQVLEARRDKNTEGPR 201 TFAKSVNSYVRAILESERRIREGKIPMTFVDRDSLRANSLAHIQATGAQPSHAPAQRVLSAPPSLPSPVSEEDPAAAATPPSSAATTPPSSVVPASVESE PPSSAATTPPSSVVP 17.630 (287) VESELSSSPPLPPVV 16.032 (304) ASVESELSSSPPLPP 14.410 (302) EDPAAAATPPSSAAT 5.190 (279) 301 LSSSPPLPPVVVKDVMYTAGEGDVVQMVVVV 1039/2881) score = 55.103 17.538 (total and max score) >gi|52139208|ref|YP_081481.1| glycoprotein UL22A [Human herpesvirus 5] 1 MARRLWILSLLAVTLTVALAAPSQKSKRSVTVEQPSTSTNSDGNTTPSKNVTLSQGGSTTDGDEDYSGGDYDVLITDTDGGNHQQPQEKTDEHKGEHTKE LSQGGSTTDGDEDYS 17.538 (60) PSKNVTLSQGGSTTD 12.668 (54) EDYSGGDYDVLITDT 9.482 (71) PSKNVTLSQGGSTTD 7.807 (54) EDYSGGDYDVLITDT 7.608 (71) 101 NEKTQ 1040/2881) score = 63.889 17.538 (total and max score) >gi|28373245|ref|NP_783776.1| UL22A [Human herpesvirus 5 strain AD169] 1 MARRLWILSLLAVTLTVALAAPSQKSKRSVTVEQPSTSADGSNTTPSKNVTLSQGGSTTDGDEDYSGEYDVLITDGDGSEHQQPQKTDEHKENQAKENEK LSQGGSTTDGDEDYS 17.538 (59) TVEQPSTSADGSNTT 12.572 (38) DEDYSGEYDVLITDG 13.303 (69) PSKNVTLSQGGSTTD 12.668 (53) PSKNVTLSQGGSTTD 7.807 (53) 101 KIQ 1059/2881) score = 33.687 17.379 (total and max score) >gi|52139316|ref|YP_081591.1| membrane glycoprotein US6 [Human herpesvirus 5] 1 MDLLIRLGFLLMCALPTPGERSSRDPKTLLSLSPRQACVPRTKSHRPVCYNDTGDCTDADDSWKQLGEDFAHQCLQAAKKRPKTHKSRPNDRNLEGRLTC AAKKRPKTHKSRPND 17.379 (84) YNDTGDCTDADDSWK 16.308 (57) 101 QRVRRLLPCDLDIHPSHRLLTLMNNCVCDGAVWNAFRLIERHGFFAVTLYLCCGITLLVVILALLCSITYESTGRGIRRCGS 1060/2881) score = 33.687 17.379 (total and max score) >gi|9625842|ref|NP_040091.1| US6 [Human herpesvirus 5 strain AD169] 1 MDLLIRLGFLLMCALPTPGERSSRDPKTLLSLSPRQQACVPRTKSHRPVCYNDTGDCTDADDSWKQLGEDFAHQCLQAAKKRPKTHKSRPNDRNLEGRLT AAKKRPKTHKSRPND 17.379 (85) YNDTGDCTDADDSWK 16.308 (58) 101 CQRVRRLLPCDLDIHPSHRLLTLMNNCVCDGAVWNAFRLIERHGFFAVTLYLCCGITLLVVILALLCSITYESTGRGIRRCGS 1069/2881) score = 156.190 17.280 (total and max score) >gi|9625733|ref|NP_039982.1| UL48 [Human herpesvirus 5 strain AD169] 1 MKVTQASCHQGDIARFGARAGNQCVCNGIMFLHALHLGGTSAVLQTEALDAIMEEGARLDARLERELQKKLPAGGRLPVYRLGDEVPRRLESRFGRTVHA 101 LSRPFNGTTETCDLDGYMCPGIFDFLRYAHAKPRPTYVLVTVNSLARAVVFTEDHMLVFDPHSSAECHNAAVYHCEGLHQVLMVLTGFGVQLSPAFYYEA 201 LFLYMLDVATVPEAEIAARLVSTYRDRDIDLTGVVRESADTAATTTTAAPSLPPLPDPIVDPGCPPGVAPSIPVYDPSSSPKKTPEKRRKDLSGSKHGGK PVYDPSSSPKKTPEK 17.280 (280) PSSSPKKTPEKRRKD 16.803 (284) EKRRKDLSGSKHGGK 12.635 (293) PVYDPSSSPKKTPEK 9.397 (280) PVYDPSSSPKKTPEK 7.441 (280) PSSSPKKTPEKRRKD 3.077 (284) 301 KKPPSTTSKTLATASSSPSAIAAASSSSAVPPSYSCGEGALPALGRYQQLVDEVEQELKALTLPPLPANTSAWTLHAAGTESGANAATATAPSFDEAFLT 401 DRLQQLIIHAVNQRSCLRRPCGPQSAAQQAVRAYLGLSKKLDAFLLNWLHHGLDLQRMHDYLSHKTTKGTYSTLDRALLEKMQVVFDPYGRQHGPALIAW 501 VEEMLRYVESKPTNELSQRLQRFVTKRPMPVSDSFVCLRPVDFQRLTQVIEQRRRVLQRQREEYHGVYEHLAGLITSIDIHDLDASDLNRREILKALQPL 601 DDNAKQELFRLGNAKMLELQMDLDRLSTQLLTRVHNHILNGFLPVEDLKQMERVVEQVLRLFYDLRDLKLCDGSYEEGFVVIREQLSYLMTGTVRDNVPL 701 LQEILQLRHAYQQATQQNEGRLTQIHDLLHVIETLVRDPGSRGSALTLALVQEQLAQLEALGGLQLPEVQQRLQNAQLALSRLYEEEEETQRFLDGLSYD RFLDGLSYDDPPNEQ 7.860 (799) RFLDGLSYDDPPNEQ 6.326 (799) 801 DPPNEQTIKRHPQLREMLRRDEQTRLRLINAVLSMFHTLVMRLARDESPRPTFFDAVSLLLQQLPPDSHEREDLRAANATYAQMVKKLEQIEKAGTGASE MRLARDESPRPTFFD 2.872 (848) LRAANATYAQMVKKL 8.730 (881) LQQLPPDSHEREDLR 5.221 (868) 901 KRFQALRELVYFFRNHEYFFQHMVGRLGVGPQVTELYERYQHEMEEQHLERLEREWQEEAGKLTVTSVEDVQRVLARAPSHRVMHQMQQTLTTKMQDFLD 1001 KEKRKQEEQQRQLLDGYQKKVQQDLQRVVDAVKGEMLSTIPHQPLEATLELLLGLDQRAQPLLDKFNQDLLSALQQLSKKLDGRINECLHGVLTGDVERR 1101 CHPHREAAMQTQASLNHLDQILGPQLLIHETQQALQHAVHQAQFIEKCQQGDPTTAITGSEFEGDFARYRSSQQKMEEQLQETRQQMTETSERLDRSLRQ PTTAITGSEFEGDFA 3.525 (1160) 1201 DPGSSSVTRVPEKPFKGQELAGRITPPPADFQQPVFKTLLDQQADAARKALSDEADLLNQKVQTQLRQRDEQLSTAQNLWTDLVTRHKMSGGLDVTTPDA 1301 KALMEKPLETLRELLGKATQQLPYLSAERTVRWMLAFLEEALAQITADPTHPHHGSRTHYRNLQQQAVESAVTLAHQIEQNAACENFIAQHQEATANGAS ATANGASTPRVDMVQ 7.091 (1401) 1401 TPRVDMVQAVEAVWQRLEPGRVAGGAARHQKVQELLQRLGQTLGDLELQETLATEYFALLHGIQTFSYGLDFRSQLEKIRDLRTRFAELAKRRGTRLSNE 1501 GVLPNPRKPQATTSLGAFTRGLNALERHVQLGHQYLLNKLNGSSLVYRLEDIPSVLPATHETDPALIMRDRLRRLCFARHHDTFLEVVDVFGMRQIVTQA 1601 GEPIHLVTDYGNVAFKYLALRDDGRPLAWRRRCSGGGLKNVVTTRYKAITVAVAVCQTLRTFWPQISQYDLRPYLTQHQSHTHPAETHTLHNLKLFCYLV 1701 STAWHQRIDTQQELTAADRVGSGEGGDVGEQRPGRGTVLRLSLQEFCVLIAALYPEYIYTVLKYPVQMSLPSLTAHLHQDVIHAVVNNTHKMPPDHLPEQ AWHQRIDTQQELTAA 12.453 (1710) ALYPEYIYTVLKYPV 15.914 (1759) 1801 VKAFCITPTQWPAMQLNKLFWENKLVQQLCQVGPQKSTPPLGKLWLYAMATLVFPQDMLQCLWLELKPQYAETYASVSELVQTLFQIFTQQCEMVTEGYT QVGPQKSTPPLGKLW 3.518 (1838) 1901 QPQLPTGEPVLQMIRVPRQDTTTTDTNTTTEPGLLDVFIQTETALDYALGSWLFGIPVCLGVHVADLLKGQRILVARHLEYTSRDRDFLRIQRSRDLNLS 2001 QLLQDTWTETPLEHCWLQAQIRRLRDYLRFPTRLEFIPLVIYNAQDHTVVRVLRPPSTFEQDHSRLVLDEAFPTFPLYDQDDNSSADNIAASGAAPTPPV VRVLRPPSTFEQDHS 16.047 (2057) 2101 PFNRVPVNIQFLRENPPPIARVQQPPRRHRHRAAAAADDDGQIDHVQDDTSRTADSALVSTAFGGSVFQENRLGETPLCRDELVAVAPGAASTSFASPPI 2201 TVLTQNVLSALEILRLVRLDLRQLAQSVQDTIQHMRFLYLL 1070/2881) score = 153.583 17.280 (total and max score) >gi|52139234|ref|YP_081506.1| large tegument protein [Human herpesvirus 5] 1 MKVTQASCHQGDIARFGARAGNQCVCNGIMFLHALHLGGTSAVLQTEALDAIMEEGARLDARLERELQKKLPAGGRLPVYRLGDEVPRRLESRFGRTVHA 101 LSRPFNGTTETCDLDGYMCPGIFDFLRYAHAKPRPTYVLVTVNSLARAVVFTEDHMLVFDPHSSAECHNAAVYHCEGLHQVLMVLTGFGVQLSPAFYYEA 201 LFLYMLDVATVPEAEIAARLVSTYRDRDIDLTGVVRESADTAATTTTAAPSLPPLPDPIVDPGCPPGVAPSIPVYDPSSSPKKTPEKRRKDLSGSKHGGK PVYDPSSSPKKTPEK 17.280 (280) PSSSPKKTPEKRRKD 16.803 (284) EKRRKDLSGSKHGGK 12.635 (293) PVYDPSSSPKKTPEK 9.397 (280) PVYDPSSSPKKTPEK 7.441 (280) PSSSPKKTPEKRRKD 3.077 (284) 301 KKPPSTTSKTLATASSSPSAIAAASSSSAVPPSYSCGEGALPALGRYQQLVDEVEQELKALTLPPLPANTSAWTLHAAGTESGANAATATAPSFDEAFLT 401 DRLQQLIIHAVNQRSCLRRPCGPQSAAQQAVRAYLGLSKKLDAFLLNWLHHGLDLQRMHDYLSHKTTKGTYSTLDRALLEKMQVVFDPYGRQHGPALIAW 501 VEEMLRYVESKPTNELSQRLQRFVTKRPMPVSDSFVCLRPVDFQRLTQVIEQRRRVLQRQREEYHGVYEHLAGLITSIDIHDLDASDLNRREILKALQPL 601 DDNAKQELFRLGNAKMLELQMDLDRLSTQLLTRVHNHILNGFLPVEDLKQMERVVEQVLRLFYDLRDLKLCDGSYEEGFVVIREQLSYLMTGTVRDNVPL 701 LQEILQLRHAYQQATQQNEGRLTQIHDLLHVIETLVRDPGSRGSALTLALVQEQLAQLEALGGLQLPEVQQRLQNAQLALSRLYEEEEETQRFLDGLSYD RFLDGLSYDDPPTEQ 7.571 (799) RFLDGLSYDDPPTEQ 7.060 (799) 801 DPPTEQTIKRHPQLREMLRRDEQTRLRLINAVLSMFHTLVMRLARDESPRPTFFDAVSLLLQQLPPDSHEREDLRAANATYAQMVKKLEQIEKAGTGASE MRLARDESPRPTFFD 2.872 (848) LRAANATYAQMVKKL 8.730 (881) LQQLPPDSHEREDLR 5.221 (868) 901 KRFQALRELVYFFRNHEYFFQHMVGRLGVGPQVTELYERYQHEMEEQHLERLEREWQEEAGKLTVTSVEDVQRVLARAPSHRVMHQMQQTLTTKMQDFLD 1001 KEKRKQEEQQRQLLDGYQKKVQQDLQRVVDAVKGEMLSTIPHQPLEATLELLLGLDQRAQPLLDKFNQDLLSALQQLSKKLDGRINECLHGVLTGDVERR 1101 CHPHREAAMQTQASLNHLDQILGPQLLIHETQQALQHAVHQAQFIEKCQQGDPTTAITGSEFESDFARYRSSQQKMEGQLQETRQQMTETSERLDRSLRQ PTTAITGSEFESDFA 3.990 (1160) 1201 DPGSSSVTRVPEKPFKGQELAGRITPPPADFQRPVFKTLLDQQADAARKALSDEADLLNQKVQTQLRQRDEQLSTAQNLWTDLVTRHKMSGGLDVTTPDA 1301 KALMEKPLETLRELLGKATQQLPYLSAERTVRWMLAFLEEALAQITADPTHPHHGSRTHYRNLQQQAVESAVTLAHQIEQNAACENFIAQHQEATANGAS ATANGASTPRVDMVQ 7.091 (1401) 1401 TPRVDMVQAVEAVWQRLEPGRVAGGAARHQKVQELLQRLGQTLGDLELQETLATEYFALLHGIQTFSYGLDFRSQLEKIRDLRTRFAELAKRCGTRLSNE 1501 GALPNPRKPQATTSLGAFTRGLNALERHVQLGHQYLLNKLNGSSLVYRLEDIPSVLPPTHETDPALIMRDRLRRLCFARHHDTFLEVVDVFGMRQIVTQA 1601 GEPIYLVTDYGNVAFKYLALRDDGRPLAWRRRCSGGGLKNVVTTRYKAITVAVAVCQTLRTFWPQISQYDLRPYLTQHQSHTHPAETHTLHNLKLFCYLV 1701 STAWHQRIDTQQELTAADRVGSGEGGDVGEQRPGRGTVLRLSLQEFCVLIAALYPEYIYTVLKYPVQMSLPSLTAHLHQDVIHAVVNNTHKMPPDHLPEQ AWHQRIDTQQELTAA 12.453 (1710) ALYPEYIYTVLKYPV 15.914 (1759) 1801 VKAFCITPTQWPAMQLNKLFWENKLVQQLCQVGPQKSTPSLGKLWLYAMATLVFPQDMLQCLWLELKPQYAETYASVSELVQTLFQIFTQQCEMVTEGYT 1901 QPQLPTGEPVLQMIRVRRQDTTTTDTNTTTEPGLLDVFIQTETALDYALGSWLFGIPVCLGVHVADLLKGQRVLVARHLEYTSRDRDFLRIQRSRDLNLS 2001 QLLQDTWTETPLEHCWLQAQIRRLRDYLRFPTRLEFIPLVIYNAQDHTVVRVLRPPSTFEQDHSRLVLDEAFPTFPLYDQDDNTSADNVAASGAAPTPPV VRVLRPPSTFEQDHS 16.047 (2057) 2101 PFNRVPVNIQFLRENPPPIARVQQPPRRHRHRAAAAADDDGQIDHAQDDTSRTADSALVSTAFGGSVFQENRLGETPLCRDELVAVAPGAASTSFASPPI 2201 TVLTQNVLSALEILRLVRLDLRQLAQSVQDTIQHMRFLYLL 1072/2881) score = 138.343 17.265 (total and max score) >gi|9625868|ref|NP_040117.1| US32 [Human herpesvirus 5 strain AD169] 1 MAMYTSESERDWRRVIHDSHGLWCDCGDWREHLYCVYDSHFQRRPTTRAERRAANWRRQMRRLHRLWCFCQDWKCHALYAEWDGKESDDESSASSSGEAP SHFQRRPTTRAERRA 14.546 (46) KESDDESSASSSGEA 17.265 (92) GKESDDESSASSSGE 16.178 (91) SDDESSASSSGEAPE 15.319 (94) KESDDESSASSSGEA 15.233 (92) DDESSASSSGEAPEQ 14.558 (95) KESDDESSASSSGEA 14.083 (92) DDESSASSSGEAPEQ 13.806 (95) AEWDGKESDDESSAS 11.457 (87) AEWDGKESDDESSAS 5.899 (87) 101 EQQVPAWKTVRAFSRAYHHRINRGLRGTPPPRNLPGYEHASEGWRFCSRRERREDDLRTRAEPDRVVFQLGGVPPRRHRETYV 1073/2881) score = 138.343 17.265 (total and max score) >gi|52139341|ref|YP_081616.1| protein US32 [Human herpesvirus 5] 1 MAMYTSESERDWRRVIHDSHGLWCDCG